1b9x

STRUCTURAL ANALYSIS OF PHOSDUCIN AND ITS PHOSPHORYLATION-REGULATED INTERACTION WITH TRANSDUCIN

Method: X-RAY DIFFRACTION D_max: 88.4 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN (TRANSDUCIN)

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 1–340	Fragment：LYS-C RESISTANT FRAGMENT, THE BETA SUBUNIT	PROTEIN (TRANSDUCIN) × 1 （P02698） PROTEIN (PHOSDUCIN) × 1 （P20942） GD GADOLINIUM ATOM × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.00 Å R-free 0.261

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1B9X	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1B9Y STRUCTURAL ANALYSIS OF PHOSDUCIN AND ITS PHOSPHORYLATION-REGULATED INTERACTION WITH TRANSDUCIN BETA-GAMMA Deposited 1999-02-16	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–340（340 aa） Fragment：LYS-C RESISTANT FRAGMENT, THE BETA SUBUNIT	Not recorded	GD GADOLINIUM ATOM × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.00 Å R-free 0.266
1GG2 G PROTEIN HETEROTRIMER MUTANT GI_ALPHA_1(G203A) BETA_1 GAMMA_2 WITH GDP BOUND Deposited 1996-11-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–339（339 aa） Fragment：BETA 1	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；pH 7.0	Resolution 2.40 Å R-free 0.289
1GOT HETEROTRIMERIC COMPLEX OF A GT-ALPHA/GI-ALPHA CHIMERA AND THE GT-BETA-GAMMA SUBUNITS Deposited 1996-08-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；277 K；10 MG/ML OF HETEROTRIMERIC COMPLEX WERE MIXED 1:1 WITH WELL SOLUTION CONTAINING 10% PEG-8000, 50 MM TRIS, PH 8.0, 10% GLYCEROL, 50 MM NACL, .1 MM MERCAPTOETHANOL. MIXTURE EQUILIBRATED VS WELL SOLUTION IN HANGING DROPS AT 4 DEGREES C., vapor diffusion - hanging drop, temperature 277K	Resolution 2.00 Å R-free 0.295
1GP2 G PROTEIN HETEROTRIMER GI_ALPHA_1 BETA_1 GAMMA_2 WITH GDP BOUND Deposited 1996-11-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–339（339 aa） Fragment：BETA 1	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；pH 7.0	Resolution 2.30 Å R-free 0.307
1OMW Crystal Structure of the complex between G Protein-Coupled Receptor Kinase 2 and Heterotrimeric G Protein beta 1 and gamma 2 subunits Deposited 2003-02-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.75；277 K；PEG 3350, Sodium Chloride, CHAPS, ATP, Magnesium Chloride, Mastoparan , MES pH 5.75, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.50 Å R-free 0.252
1XHM The Crystal Structure of a Biologically Active Peptide (SIGK) Bound to a G Protein Beta:Gamma Heterodimer Deposited 2004-09-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–340（340 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；PEG 4000, GLYCEROL, HEPES, PH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.70 Å R-free 0.287
24XZ P2Y14R-Gi complex bound to UDP Deposited 2026-03-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 2–340（339 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.93 Å
2BCJ Crystal Structure of G Protein-Coupled Receptor Kinase 2 in Complex with Galpha-q and Gbetagamma Subunits Deposited 2005-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 2–340（339 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；9% PEG8000, 1M NaCl, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.06 Å R-free 0.292
2TRC PHOSDUCIN/TRANSDUCIN BETA-GAMMA COMPLEX Deposited 1997-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa） Fragment：LYS-C RESISTANT FRAGMENT, THE GAMMA SUBUNIT CLEAVED AFTER RESIDUE 68	Not recorded	GD GADOLINIUM ATOM × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；277 K；THE PROTEIN COMPLEX (10 MG/ML SOLUTION) WAS CRYSTALLIZED FROM 50 MM SODIUM CITRATE (PH 5.0), 150 MM MAGNESIUM ACETATE, 9.5% PEG 8000, BY HANGING DROP METHOD AT 4 DEGREES C., vapor diffusion - hanging drop, temperature 277K	Resolution 2.40 Å R-free 0.277
3AH8 Structure of heterotrimeric G protein Galpha-q beta gamma in complex with an inhibitor YM-254890 Deposited 2010-04-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–340（340 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.1；293 K；7% PEG 4000, 30% (v/v) glycerol, 70 mM acetate-NaOH, pH 5.1, VAPOR DIFFUSION, temperature 293K	Resolution 2.90 Å R-free 0.315
3CIK Human GRK2 in Complex with Gbetagamma subunits Deposited 2008-03-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.25；277 K；200 mM NaCl, 5% ethylene glycol, 6.3% PEG 3350, pH 5.25, vapor diffusion, hanging drop, temperature 277K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.75 Å R-free 0.269
3KRW Human GRK2 in complex with Gbetgamma subunits and balanol (soak) Deposited 2009-11-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	BA1 BALANOL × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions 277 K；Well contained 100 mM MES, pH 5.6, 200 mM NaCl, 9% PEG 3350. Drops were 1 uL protein, 1 uL well, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.90 Å R-free 0.265
3KRX Human GRK2 in complex with Gbetgamma subunits and balanol (co-crystal) Deposited 2009-11-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	BA1 BALANOL × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions 277 K；Well contained 100 mM MES, pH 6.0, 200 mM NaCl, 9% PEG 3350. Drops were 1 uL protein, 1 uL well, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.10 Å R-free 0.270
3PSC Bovine GRK2 in complex with Gbetagamma subunits Deposited 2010-12-01	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；9% PEG3350, 200 mM NaCl, 100 mM MES pH 6.5, 1 mM ATP, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.67 Å R-free 0.257
3PVU Bovine GRK2 in complex with Gbetagamma subunits and a selective kinase inhibitor (CMPD101) Deposited 2010-12-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	QRW 3-({[4-methyl-5-(pyridin-4-yl)-4H-1,2,4-triazol-3-yl]methyl}amino)-N-[2-(trifluoromethyl)benzyl]benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.25；277 K；7% PEG3350, 200 mM NaCl, 100 mM MES pH 5.25, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.48 Å R-free 0.274
3PVW Bovine GRK2 in complex with Gbetagamma subunits and a selective kinase inhibitor (CMPD103A) Deposited 2010-12-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	QRX N-(2,6-difluorobenzyl)-3-({[4-propyl-5-(pyrimidin-4-yl)-4H-1,2,4-triazol-3-yl]methyl}amino)benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.25；277 K；7% PEG3350, 250 mM NaCl, 100 mM MES pH 6.25, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.49 Å R-free 0.285
3UZS Structure of the C13.28 RNA Aptamer Bound to the G Protein-Coupled Receptor Kinase 2-Heterotrimeric G Protein Beta 1 and Gamma 2 Subunit Complex Deposited 2011-12-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 3 PDB declaration: tetrameric	Chain B 1–340（340 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；100 mM Tris pH 8.5, 200 mM NaCl and 3% PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.52 Å R-free 0.268
3V5W Human G Protein-Coupled Receptor Kinase 2 in Complex with Soluble Gbetagamma Subunits and Paroxetine Deposited 2011-12-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	8PR Paroxetine × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.8；277 K；100 mM MES pH 5.8, 200 mM NaCl, and 8% (w/v) PEG3350, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.07 Å R-free 0.247
4MK0 Crystal structure of G protein-coupled receptor kinase 2 in complex with a a rationally designed paroxetine derivative Deposited 2013-09-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 2–340（339 aa）	Not recorded	GOL GLYCEROL × 1 29X 5-{[(3S,4R)-4-(4-fluorophenyl)piperidin-3-yl]methoxy}-1H-isoindol-1-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；277 K；6% PEG 3350, 1M NaCl, 2 mM MgCl2, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.40 Å R-free 0.238
5KDO Heterotrimeric complex of the 4 alanine insertion variant of the Gi alpha1 subunit and the Gbeta1-Ggamma1 Deposited 2016-06-08	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；19-24 % PEG 8000, 1-5% 2-propanolol, 1% OG, 100 mM HEPES (pH 7.0) and 100 mM NaOAc (pH 6.4)	Resolution 1.90 Å R-free 0.208
5WG3 Human GRK2 in complex with Gbetagamma subunits and CCG258748 Deposited 2017-07-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	AFM 2-fluoro-5-[(3S,4R)-3-{[(1H-indazol-5-yl)oxy]methyl}piperidin-4-yl]-N-[(1H-pyrazol-3-yl)methyl]benzamide × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；50 mM MES pH 6, 1.1 M NaCl, 8% PEG3350	Resolution 2.90 Å R-free 0.248
5WG4 Human GRK2 in complex with Gbetagamma subunits and CCG257284 Deposited 2017-07-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	AFV 2-fluoro-5-[(3S,4R)-3-{[(1H-indazol-5-yl)oxy]methyl}piperidin-4-yl]-N-[(pyridin-2-yl)methyl]benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；50 mM MES pH 6, 6% PEG 3350, 1 M NaCl	Resolution 2.31 Å R-free 0.279
5WG5 Human GRK2 in complex with Gbetagamma subunits and CCG224061 Deposited 2017-07-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	ZSO 5-{[(3S,4R)-4-(4-fluorophenyl)piperidin-3-yl]methoxy}-2H-indazole × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；50 mM MES pH 6, 8-15% PEG3350, 0.8-1.2 M NaCl	Resolution 3.10 Å R-free 0.232
6B20 Crystal structure of a complex between G protein beta gamma dimer and an inhibitory Nanobody regulator Deposited 2017-09-19	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 3–340（338 aa）	Mutation：V71L	UNX UNKNOWN LIGAND × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；277.15 K；25-30% (w/v) PEG 3350 in 0.1-0.2 M Bis-Tris-HCl, pH 5.5-5.7, and 0.2-0.3 M MgCl2	Resolution 2.34 Å R-free 0.249
6B20 Crystal structure of a complex between G protein beta gamma dimer and an inhibitory Nanobody regulator Deposited 2017-09-19	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 3–340（338 aa）	Mutation：V71L	UNX UNKNOWN LIGAND × 5 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；277.15 K；25-30% (w/v) PEG 3350 in 0.1-0.2 M Bis-Tris-HCl, pH 5.5-5.7, and 0.2-0.3 M MgCl2	Resolution 2.34 Å R-free 0.249
6C2Y Human GRK2 in complex with Gbetagamma subunits and CCG257142 Deposited 2018-01-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	EJS (4R,5R,6S)-4-[4-fluoro-3-({[3-(methoxymethyl)-1,2,4-oxadiazol-5-yl]methyl}carbamoyl)phenyl]-N-(2H-indazol-5-yl)-6-methyl-2-oxohexahydropyrimidine-5-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；50 mM MES pH 6.0, 800 mM NaCl, 8% PEG 3350	Resolution 2.74 Å R-free 0.292
6OY9 Structure of the Rhodopsin-Transducin Complex Deposited 2019-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–340（340 aa）	Not recorded	RET RETINAL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6OYA Structure of the Rhodopsin-Transducin-Nanobody Complex Deposited 2019-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–340（340 aa）	Not recorded	RET RETINAL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot for 1 second before plunging; avoid light as much as possible.	Resolution 3.30 Å
6PCV Single Particle Reconstruction of Phosphatidylinositol (3,4,5) trisphosphate-dependent Rac exchanger 1 bound to G protein beta gamma subunits Deposited 2019-06-18	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6QNO Rhodopsin-Gi protein complex Deposited 2019-02-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–340（340 aa）	Not recorded	RET RETINAL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；The detergent lauryl-maltose neopentyl glycol (LMNG) was used before the last purification step by gel filtration. In the gel filtration, detergent-free buffer was used. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.38 Å
6U7C Human GRK2 in complex with Gbetagamma subunits and CCG258747 Deposited 2019-09-02	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	Q1Y 5-[(3S,4R)-3-{[(2H-1,3-benzodioxol-5-yl)oxy]methyl}piperidin-4-yl]-2-fluoro-N-[(2H-indazol-3-yl)methyl]benzamide × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；50 mM MES pH 6.0, 1.1 M NaCl, 6% PEG 3350	Resolution 2.44 Å R-free 0.262
7BZ2 Cryo-EM structure of the formoterol-bound beta2 adrenergic receptor-Gs protein complex. Deposited 2020-04-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–340（340 aa）	Not recorded	H98 ~{N}-[5-[(1~{R})-2-[[(2~{R})-1-(4-methoxyphenyl)propan-2-yl]amino]-1-oxidanyl-ethyl]-2-oxidanyl-phenyl]methanamide × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.82 Å
7D68 Cryo-EM structure of the human glucagon-like peptide-2 receptor-Gs protein complex Deposited 2020-09-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 2–340（339 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7DHI Cryo-EM structure of the partial agonist salbutamol-bound beta2 adrenergic receptor-Gs protein complex. Deposited 2020-11-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–340（340 aa）	Not recorded	68H SALBUTAMOL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.26 Å
7DHR Cryo-EM structure of the full agonist isoprenaline-bound beta2 adrenergic receptor-Gs protein complex. Deposited 2020-11-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–340（340 aa）	Not recorded	5FW ISOPRENALINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7E14 Compound2_GLP-1R_OWL833_Gs complex structure Deposited 2021-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 2–340（339 aa）	Not recorded	V6G 3-[(1S,2S)-1-(5-[(4S)-2,2-dimethyloxan-4-yl]-2-{(4S)-2-(4-fluoro-3,5-dimethylphenyl)-3-[3-(4-fluoro-1-methyl-1H-indazol-5-yl)-2-oxo-2,3-dihydro-1H-imidazol-1-yl]-4-methyl-2,4,6,7-tetrahydro-5H-pyrazolo[4,3-c]pyridine-5-carbonyl}-1H-indol-1-yl)-2-methylcyclopropyl]-1,2,4-oxadiazol-5(4H)-one × 1 CLR CHOLESTEROL × 5 HNO N-tert-butyl-6,7-bis(chloranyl)quinoxalin-2-amine × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7JJO Structural Basis of the Activation of Heterotrimeric Gs-protein by Isoproterenol-bound Beta1-Adrenergic Receptor Deposited 2020-07-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 2–340（339 aa）	Not recorded	5FW ISOPRENALINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
7O7F Structural basis of the activation of the CC chemokine receptor 5 by a chemokine agonist Deposited 2021-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 1–340（340 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7PWD Structure of an inhibited GRK2-G-beta and G-gamma complex Deposited 2021-10-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–340（340 aa）	Not recorded	8DS 4-chloranyl-N-[2-(4-chlorophenyl)ethyl]thieno[2,3-c]pyridine-2-carboxamide × 1 CL CHLORIDE ION × 2 1PE PENTAETHYLENE GLYCOL × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；ethylene glycol, PEG 3350, MES, NaCl	Resolution 2.60 Å R-free 0.230
7S0F Isoproterenol bound beta1 adrenergic receptor in complex with heterotrimeric Gi protein Deposited 2021-08-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 2–340（339 aa）	Not recorded	5FW ISOPRENALINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.96 Å
7S0G Isoproterenol bound beta1 adrenergic receptor in complex with heterotrimeric Gi/s chimera protein Deposited 2021-08-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 2–340（339 aa）	Not recorded	5FW ISOPRENALINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.86 Å
7SQO Structure of the orexin-2 receptor(OX2R) bound to TAK-925, Gi and scFv16 Deposited 2021-11-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 2–340（339 aa）	Not recorded	OLA OLEIC ACID × 4 A6F methyl (2R,3S)-3-[(methanesulfonyl)amino]-2-({[(1s,4S)-4-phenylcyclohexyl]oxy}methyl)piperidine-1-carboxylate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
7TD0 Lysophosphatidic acid receptor 1-Gi complex bound to LPA Deposited 2021-12-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–340（340 aa）	Not recorded	NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.83 Å
7TD1 Lysophosphatidic acid receptor 1-Gi complex bound to LPA, state a Deposited 2021-12-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–340（340 aa）	Not recorded	NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.08 Å
7TD2 Lysophosphatidic acid receptor 1-Gi complex bound to LPA, state a Deposited 2021-12-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–340（340 aa）	Not recorded	NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.11 Å
7TD3 Sphingosine-1-phosphate receptor 1-Gi complex bound to S1P Deposited 2021-12-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–340（340 aa）	Not recorded	S1P (2S,3R,4E)-2-amino-3-hydroxyoctadec-4-en-1-yl dihydrogen phosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7TD4 Sphingosine-1-phosphate receptor 1-Gi complex bound to Siponimod Deposited 2021-12-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–340（340 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 J8C 1-[[4-[(~{E})-~{N}-[[4-cyclohexyl-3-(trifluoromethyl)phenyl]methoxy]-~{C}-methyl-carbonimidoyl]-2-ethyl-phenyl]methyl]azetidine-3-carboxylic acid × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
7X1T Structure of Thyrotropin-Releasing Hormone Receptor bound with Taltirelin. Deposited 2022-02-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–340（340 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.26 Å
7X1U Structure of Thyrotropin-Releasing Hormone Receptor bound with an Endogenous Peptide Agonist TRH. Deposited 2022-02-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–340（340 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
7XAT Structure of somatostatin receptor 2 bound with SST14. Deposited 2022-03-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 2–340（339 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
7XAU Structure of somatostatin receptor 2 bound with octreotide. Deposited 2022-03-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 2–340（339 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
7XAV Structure of somatostatin receptor 2 bound with lanreotide. Deposited 2022-03-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 2–340（339 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.87 Å
7YJ4 Cryo-EM structure of the INSL5-bound human relaxin family peptidereceptor 4 (RXFP4)-Gi complex Deposited 2022-07-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain T 2–340（339 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
8DCR Cryo-EM structure of dobutamine-bound beta1-adrenergic receptor in complex with heterotrimeric Gs-protein Deposited 2022-06-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 2–340（339 aa）	Not recorded	Y00 DOBUTAMINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
8DCS Cryo-EM structure of cyanopindolol-bound beta1-adrenergic receptor in complex with heterotrimeric Gs-protein Deposited 2022-06-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 2–340（339 aa）	Not recorded	P32 Cyanopindolol × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
8P12 Cryo-EM structure of Rhodopsin-Gi bound to antibody fragment Fab13 Deposited 2023-05-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–340（340 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM HEPES (pH 7.5), 100 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.21 Å
8P13 Cryo-EM structure of Rhodopsin-Gi bound with antibody fragments scFv16 and Fab79, conformation 1 Deposited 2023-05-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 1–340（340 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM HEPES (pH 7.5), 100 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.20 Å
8P15 Cryo-EM structure of Rhodopsin-Gi bound with antibody fragments scFv16 and Fab79, conformation 2 Deposited 2023-05-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 1–340（340 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM HEPES (pH 7.5), 100 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8SOC Phosphoinositide phosphate 3 kinase gamma bound with ADP and Gbetagamma Deposited 2023-04-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–340（340 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 2	Resolution 3.50 Å
8SOD Phosphoinositide phosphate 3 kinase gamma bound with ADP and two Gbetagamma subunits in State 1 Deposited 2023-04-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–340（340 aa） Chain E 1–340（340 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 2	Resolution 3.40 Å
8SOE Phosphoinositide phosphate 3 kinase gamma bound with ADP and two Gbetagamma subunits in State 2 Deposited 2023-04-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–340（340 aa） Chain E 1–340（340 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 2	Resolution 3.60 Å
8YH0 A3R-Gi complex bound to NECA Deposited 2024-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 2–340（339 aa）	Not recorded	NEC N-ETHYL-5'-CARBOXAMIDO ADENOSINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.86 Å
8YH2 A3R-Gi complex bound to adenosine Deposited 2024-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 2–340（339 aa）	Not recorded	ADN ADENOSINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.27 Å
8YH3 A3R-Gi complex bound to m6A Deposited 2024-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 2–340（339 aa）	Not recorded	6MD N-methyladenosine × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8YH5 A3R-Gi complex bound to i6A Deposited 2024-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 2–340（339 aa）	Not recorded	ZIR N-(3-methylbut-2-en-1-yl)adenosine × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.66 Å
8YH6 A3R-Gi complex bound to namodenoson Deposited 2024-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 2–340（339 aa）	Not recorded	XS0 namodenoson × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
8YKD Cryo-EM structure of ADGRG2-Gs complex with NTF nanobody Deposited 2024-03-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 2–340（339 aa）	Not recorded	AND 3-BETA-HYDROXY-5-ANDROSTEN-17-ONE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9CBL Cryo-EM structure of epinephrine-bound alpha-2A-adrenergic receptor in complex with heterotrimeric Gi-protein Deposited 2024-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 2–340（339 aa）	Not recorded	ALE L-EPINEPHRINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9CBM Cryo-EM structure of dexmedetomidine-bound alpha-2A-adrenergic receptor in complex with heterotrimeric Gi-protein Deposited 2024-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 2–340（339 aa）	Not recorded	CZX 4-[(1~{S})-1-(2,3-dimethylphenyl)ethyl]-1~{H}-imidazole × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9EPR Cryo-EM Structure of Jumping Spider Rhodopsin-1 bound to a Gi heterotrimer Deposited 2024-03-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–340（340 aa）	Not recorded	RET RETINAL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.90 Å
9Y7H Gb1g2 crosslinked to PLCb3 Deposited 2025-09-10	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 8–339（332 aa）	Not recorded	ME7 1,1'-ethane-1,2-diylbis(1H-pyrrole-2,5-dione) × 1 CA CALCIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM HEPES pH 7.4, 100 mM NaCl, 0.1 mM EDTA and 0.1 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
9YAO Gbg crosslinked to PLCb3 - second conformation Deposited 2025-09-16	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 8–339（332 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM HEPES pH 7.4, 100 mM NaCl, 0.1 mM EDTA and 0.1 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å
9YAP Gbg crosslinked to PLCb3 - second conformation Deposited 2025-09-16	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 2–340（339 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM HEPES pH 7.4, 100 mM NaCl, 0.1 mM EDTA and 0.1 mM EGTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å

72 other PDB entries and 73 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GBB1_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–340； UniProt 1–340

PROTEIN (TRANSDUCIN)

OrganismNot specified

UniProt P02698

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain B； UniProt 1–67	Fragment：LYS-C RESISTANT FRAGMENT, THE GAMMA SUBUNIT CLEAVED AFTER RESIDUE 68	PROTEIN (TRANSDUCIN) × 1 （P62871） PROTEIN (PHOSDUCIN) × 1 （P20942） GD GADOLINIUM ATOM × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.00 Å R-free 0.261

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 1B9X	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1A0R HETEROTRIMERIC COMPLEX OF PHOSDUCIN/TRANSDUCIN BETA-GAMMA Deposited 1997-12-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 1–65（65 aa）	Not recorded	FAR FARNESYL × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 6.8；277 K；THE PROTEIN COMPLEX (10 MG/ML SOLUTION) WAS CRYSTALLIZED FROM 400 MM SODIUM CACODYLATE (PH 6.8), 1 MM ZINC CHLORIDE, 25 % ETHYLENE GLYCOL, 12 % PEG 8000, BY MICROBATCH CRYSTALLIZATION AT 4 DEGREES C., microbatch, temperature 277K	Resolution 2.80 Å R-free 0.264
1B9Y STRUCTURAL ANALYSIS OF PHOSDUCIN AND ITS PHOSPHORYLATION-REGULATED INTERACTION WITH TRANSDUCIN BETA-GAMMA Deposited 1999-02-16	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–67（67 aa） Fragment：LYS-C RESISTANT FRAGMENT, THE GAMMA SUBUNIT CLEAVED AFTER RESIDUE 68	Not recorded	GD GADOLINIUM ATOM × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.00 Å R-free 0.266
1GOT HETEROTRIMERIC COMPLEX OF A GT-ALPHA/GI-ALPHA CHIMERA AND THE GT-BETA-GAMMA SUBUNITS Deposited 1996-08-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 1–65（65 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；277 K；10 MG/ML OF HETEROTRIMERIC COMPLEX WERE MIXED 1:1 WITH WELL SOLUTION CONTAINING 10% PEG-8000, 50 MM TRIS, PH 8.0, 10% GLYCEROL, 50 MM NACL, .1 MM MERCAPTOETHANOL. MIXTURE EQUILIBRATED VS WELL SOLUTION IN HANGING DROPS AT 4 DEGREES C., vapor diffusion - hanging drop, temperature 277K	Resolution 2.00 Å R-free 0.295
1MF6 Transducin gamma subunit, C-terminal domain 60-71, rhodopsin-bound state: Ensemble of 15 models determined by TrNOE spectroscopy Deposited 2002-08-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 60–71（12 aa） Fragment：Residues 60-71	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；277 K NMR sample composition 0.1 mM Rhodopsin, 2 mM peptide DKNPFKELKGGC-farnesyl. \| 90% H2O/10% D2O	Resolution not provided
1TBG BETA-GAMMA DIMER OF THE HETEROTRIMERIC G-PROTEIN TRANSDUCIN Deposited 1996-06-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–67（67 aa） Fragment：GAMMA-1 SUBUNIT Chain F 1–67（67 aa） Fragment：GAMMA-1 SUBUNIT Chain G 1–67（67 aa） Fragment：GAMMA-1 SUBUNIT Chain H 1–67（67 aa） Fragment：GAMMA-1 SUBUNIT	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；277 K；15-20 MG/ML PROTEIN MIXED 1:1 WITH WELL SOLUTION (10MM FUMARATE, PH 4.2, 10MM MGSO4, 2MM GDCL3, 5% W/V GLYCEROL, 5% W/V PEG 4000, 15MM BETA-MERCAPTOETHANOL. MIXTURE EQUILIBRATED VS. WELL SOLUTION IN HANGING DROPS AT 4 DEGREES CELSIUS., vapor diffusion - hanging drop, temperature 277K	Resolution 2.10 Å R-free 0.306
1TBG BETA-GAMMA DIMER OF THE HETEROTRIMERIC G-PROTEIN TRANSDUCIN Deposited 1996-06-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1–67（67 aa） Fragment：GAMMA-1 SUBUNIT	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；277 K；15-20 MG/ML PROTEIN MIXED 1:1 WITH WELL SOLUTION (10MM FUMARATE, PH 4.2, 10MM MGSO4, 2MM GDCL3, 5% W/V GLYCEROL, 5% W/V PEG 4000, 15MM BETA-MERCAPTOETHANOL. MIXTURE EQUILIBRATED VS. WELL SOLUTION IN HANGING DROPS AT 4 DEGREES CELSIUS., vapor diffusion - hanging drop, temperature 277K	Resolution 2.10 Å R-free 0.306
1TBG BETA-GAMMA DIMER OF THE HETEROTRIMERIC G-PROTEIN TRANSDUCIN Deposited 1996-06-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–67（67 aa） Fragment：GAMMA-1 SUBUNIT	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；277 K；15-20 MG/ML PROTEIN MIXED 1:1 WITH WELL SOLUTION (10MM FUMARATE, PH 4.2, 10MM MGSO4, 2MM GDCL3, 5% W/V GLYCEROL, 5% W/V PEG 4000, 15MM BETA-MERCAPTOETHANOL. MIXTURE EQUILIBRATED VS. WELL SOLUTION IN HANGING DROPS AT 4 DEGREES CELSIUS., vapor diffusion - hanging drop, temperature 277K	Resolution 2.10 Å R-free 0.306
1TBG BETA-GAMMA DIMER OF THE HETEROTRIMERIC G-PROTEIN TRANSDUCIN Deposited 1996-06-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–67（67 aa） Fragment：GAMMA-1 SUBUNIT	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；277 K；15-20 MG/ML PROTEIN MIXED 1:1 WITH WELL SOLUTION (10MM FUMARATE, PH 4.2, 10MM MGSO4, 2MM GDCL3, 5% W/V GLYCEROL, 5% W/V PEG 4000, 15MM BETA-MERCAPTOETHANOL. MIXTURE EQUILIBRATED VS. WELL SOLUTION IN HANGING DROPS AT 4 DEGREES CELSIUS., vapor diffusion - hanging drop, temperature 277K	Resolution 2.10 Å R-free 0.306
1TBG BETA-GAMMA DIMER OF THE HETEROTRIMERIC G-PROTEIN TRANSDUCIN Deposited 1996-06-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1–67（67 aa） Fragment：GAMMA-1 SUBUNIT	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；277 K；15-20 MG/ML PROTEIN MIXED 1:1 WITH WELL SOLUTION (10MM FUMARATE, PH 4.2, 10MM MGSO4, 2MM GDCL3, 5% W/V GLYCEROL, 5% W/V PEG 4000, 15MM BETA-MERCAPTOETHANOL. MIXTURE EQUILIBRATED VS. WELL SOLUTION IN HANGING DROPS AT 4 DEGREES CELSIUS., vapor diffusion - hanging drop, temperature 277K	Resolution 2.10 Å R-free 0.306
2TRC PHOSDUCIN/TRANSDUCIN BETA-GAMMA COMPLEX Deposited 1997-01-06	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 1–67（67 aa） Fragment：LYS-C RESISTANT FRAGMENT, THE GAMMA SUBUNIT CLEAVED AFTER RESIDUE 68	Not recorded	GD GADOLINIUM ATOM × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；277 K；THE PROTEIN COMPLEX (10 MG/ML SOLUTION) WAS CRYSTALLIZED FROM 50 MM SODIUM CITRATE (PH 5.0), 150 MM MAGNESIUM ACETATE, 9.5% PEG 8000, BY HANGING DROP METHOD AT 4 DEGREES C., vapor diffusion - hanging drop, temperature 277K	Resolution 2.40 Å R-free 0.277
5KDO Heterotrimeric complex of the 4 alanine insertion variant of the Gi alpha1 subunit and the Gbeta1-Ggamma1 Deposited 2016-06-08	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 1–74（74 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；19-24 % PEG 8000, 1-5% 2-propanolol, 1% OG, 100 mM HEPES (pH 7.0) and 100 mM NaOAc (pH 6.4)	Resolution 1.90 Å R-free 0.208
6B20 Crystal structure of a complex between G protein beta gamma dimer and an inhibitory Nanobody regulator Deposited 2017-09-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 7–66（60 aa）	Not recorded	UNX UNKNOWN LIGAND × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；277.15 K；25-30% (w/v) PEG 3350 in 0.1-0.2 M Bis-Tris-HCl, pH 5.5-5.7, and 0.2-0.3 M MgCl2	Resolution 2.34 Å R-free 0.249
6B20 Crystal structure of a complex between G protein beta gamma dimer and an inhibitory Nanobody regulator Deposited 2017-09-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 7–66（60 aa）	Not recorded	UNX UNKNOWN LIGAND × 5 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；277.15 K；25-30% (w/v) PEG 3350 in 0.1-0.2 M Bis-Tris-HCl, pH 5.5-5.7, and 0.2-0.3 M MgCl2	Resolution 2.34 Å R-free 0.249
6OY9 Structure of the Rhodopsin-Transducin Complex Deposited 2019-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 2–74（73 aa）	Not recorded	RET RETINAL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6OYA Structure of the Rhodopsin-Transducin-Nanobody Complex Deposited 2019-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain G 2–74（73 aa）	Not recorded	RET RETINAL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot for 1 second before plunging; avoid light as much as possible.	Resolution 3.30 Å
6QNO Rhodopsin-Gi protein complex Deposited 2019-02-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain G 1–74（74 aa）	Not recorded	RET RETINAL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；The detergent lauryl-maltose neopentyl glycol (LMNG) was used before the last purification step by gel filtration. In the gel filtration, detergent-free buffer was used. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.38 Å
7O7F Structural basis of the activation of the CC chemokine receptor 5 by a chemokine agonist Deposited 2021-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain G 1–74（74 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
8P12 Cryo-EM structure of Rhodopsin-Gi bound to antibody fragment Fab13 Deposited 2023-05-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain G 1–74（74 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM HEPES (pH 7.5), 100 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.21 Å
8P13 Cryo-EM structure of Rhodopsin-Gi bound with antibody fragments scFv16 and Fab79, conformation 1 Deposited 2023-05-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain G 1–74（74 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM HEPES (pH 7.5), 100 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.20 Å
8P15 Cryo-EM structure of Rhodopsin-Gi bound with antibody fragments scFv16 and Fab79, conformation 2 Deposited 2023-05-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain G 1–74（74 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM HEPES (pH 7.5), 100 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
9EPR Cryo-EM Structure of Jumping Spider Rhodopsin-1 bound to a Gi heterotrimer Deposited 2024-03-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 1–74（74 aa）	Not recorded	RET RETINAL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.90 Å

16 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GBG1_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–68； UniProt 1–67

PROTEIN (PHOSDUCIN)

Rattus norvegicus

UniProt P20942

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain C； UniProt 1–246	Mutation：S73E	PROTEIN (TRANSDUCIN) × 1 （P62871） PROTEIN (TRANSDUCIN) × 1 （P02698） GD GADOLINIUM ATOM × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.00 Å R-free 0.261

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 1B9X	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1B9Y STRUCTURAL ANALYSIS OF PHOSDUCIN AND ITS PHOSPHORYLATION-REGULATED INTERACTION WITH TRANSDUCIN BETA-GAMMA Deposited 1999-02-16	Different mutation/modification Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–246（246 aa）	Not recorded	GD GADOLINIUM ATOM × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.00 Å R-free 0.266
2TRC PHOSDUCIN/TRANSDUCIN BETA-GAMMA COMPLEX Deposited 1997-01-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 14–230（217 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	GD GADOLINIUM ATOM × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；277 K；THE PROTEIN COMPLEX (10 MG/ML SOLUTION) WAS CRYSTALLIZED FROM 50 MM SODIUM CITRATE (PH 5.0), 150 MM MAGNESIUM ACETATE, 9.5% PEG 8000, BY HANGING DROP METHOD AT 4 DEGREES C., vapor diffusion - hanging drop, temperature 277K	Resolution 2.40 Å R-free 0.277

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PHOS_RAT
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–246； UniProt 1–246

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1b9x
Deposition date deposition_date	1999-02-16
Structure title title	STRUCTURAL ANALYSIS OF PHOSDUCIN AND ITS PHOSPHORYLATION-REGULATED INTERACTION WITH TRANSDUCIN
Keywords keywords	;PHOSDUCIN, TRANSDUCIN, BETA-GAMMA, SIGNAL TRANSDUCTION, REGULATION, PHOSPHORYLATION, G PROTEINS, THIOREDOXIN, VISION, MEKA, COMPLEX (TRANSDUCER- TRANSDUCTION), SIGNALING PROTEIN ;; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	26.29 Å
Radius of gyration Rg (electron density) rg_electron	25.43 Å
Forward intensity I(0) i0	77886600.00
Molecular weight molecular_weight	65383.0 kDa
Excluded volume excluded_volume	79970 Å³
Envelope volume envelope_volume	97876 Å³
Hydration-shell volume shell_volume	31870 Å³
Envelope diameter envelope_diameter	95.8 Å
Shell Rg shell_rg	33.08 Å
Envelope Rg envelope_rg	25.79 Å
Shape Rg shape_rg	25.40 Å
Total Rg total_rg	26.25 Å
Total atoms total_atoms	4520
Residues n_residues	577
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	88.4 Å
Rg (real space) rg_real	26.25 Å
Rg uncertainty (real space) rg_real_error	0.68 Å
I(0) (real space) i0_real	7.7890e+07
I(0) uncertainty (real space) i0_real_error	1.1800e+06
Rg (reciprocal space) rg_reciprocal	26.26 Å
I(0) (reciprocal space) i0_reciprocal	77890000.0000
Solution quality estimate total_estimate	0.7996
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	32.4 Å
Skewness Skewness skewness	0.352
Kurtosis Kurtosis kurtosis	-0.222
Angular range angular_range	— – 0.3000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	15200000.0000
Real-space data points n_real_points	61
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.799; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.992; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	PROTEIN (TRANSDUCIN)
Molecular weight formula_weight	37431.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	4538

MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN

Entity 2 Entity 2 polymer

Description description	PROTEIN (TRANSDUCIN)
Molecular weight formula_weight	8040.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEFRDYVEERSGEDPLVKGIPEDKNPFKELK

Entity 3 Entity 3 polymer

Description description	PROTEIN (PHOSDUCIN)
Molecular weight formula_weight	28204.3 kDa
Mutation mutation	S73E
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MEEAASQSLEEDFEGQATHTGPKGVINDWRKFKLESEDGDSIPPSKKEILRQMSSPQSRDDKDSKERMSRKMEIQEYELIHQDKEDEGCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIEKEQKVTTIVVNIYEDGVRGCDALNSSLECLAAEYPMVKFCKIRASNTGAGDRFSSDVLPTLLVYKGGELISNFISVAEQFAEDFFAADVESFLNEYGLLPEREIHDLGQTNTEDEDIE

来源 Source

来源生物 organism	Rattus norvegicus
通用名 common_name	Norway rat
NCBI Class编号 ncbi_taxonomy_id	10116
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 non-polymer

Description description	GADOLINIUM ATOM
Molecular weight formula_weight	157.2 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	18

▼

7. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1b9xa_
Class class	b — All beta proteins
Fold Fold fold	b.69 — 7-bladed beta-propeller
Superfamily Superfamily superfamily	b.69.4 — WD40 repeat-like
Family Family family	b.69.4.1 — WD40-repeat

Domain ID domain_id	d1b9xb_
Class class	a — All alpha proteins
Fold Fold fold	a.137 — Non-globular all-alpha subunits of globular proteins
Superfamily Superfamily superfamily	a.137.3 — Transducin (heterotrimeric G protein), gamma chain
Family Family family	a.137.3.1 — Transducin (heterotrimeric G protein), gamma chain

Domain ID domain_id	d1b9xc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.47 — Thioredoxin fold
Superfamily Superfamily superfamily	c.47.1 — Thioredoxin-like
Family Family family	c.47.1.6 — Phosducin

CATH v4.4 (4 domains)

Domain ID domain_id	1b9xA00
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

Domain ID domain_id	1b9xB00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	260 — G Protein Gi Gamma 2
Homologous superfamily homologous superfamily	10 — Transducin (heterotrimeric G protein), gamma chain

Domain ID domain_id	1b9xC01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	10 — Glutaredoxin

Domain ID domain_id	1b9xC02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	168 — Phosducin; domain 2
Homologous superfamily homologous superfamily	10 — Phosducin, domain 2

▶

8. Citations (2)

▶

Unit-cell length a length_a	76.040 Å
Unit-cell length b length_b	89.330 Å
Unit-cell length c length_c	100.150 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	—
R_work r_work	0.2170
R_free r_free	0.2610

fit	/app/data/saxs_computation/b9/1b9x/1b9x.fit
pddf	/app/data/pr_computation/b9/1b9x/1b9x.pr.out
profile	/app/data/saxs_computation/b9/1b9x/1b9x.dat

STRUCTURAL ANALYSIS OF PHOSDUCIN AND ITS PHOSPHORYLATION-REGULATED INTERACTION WITH TRANSDUCIN

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN (TRANSDUCIN)

State in the Current Structure

Other States of the Same Protein in the Database

PROTEIN (TRANSDUCIN)

State in the Current Structure

Other States of the Same Protein in the Database

PROTEIN (PHOSDUCIN)

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

CATH v4.4 (4 domains)

8. Citations (2)

9. Files and Curves (10)

Files (7)

Curves (3)