SAXSdb — 1ela

▼

1. Structure Basics

entry_id	1ela
deposition_date	1993-12-07
title	Analogous inhibitors of elastase do not always bind analogously
keywords	HYDROLASE-HYDROLASE INHIBITOR COMPLEX, SERINE PROTEINASE; HYDROLASE/HYDROLASE INHIBITOR
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	17.65 Å
rg_electron	16.62 Å
i0	24517500.00
molecular_weight	24744.0 kDa
excluded_volume	23564 Å³
envelope_volume	36969 Å³
shell_volume	18096 Å³
envelope_diameter	54.8 Å
shell_rg	23.34 Å
envelope_rg	16.91 Å
shape_rg	16.61 Å
total_rg	17.38 Å
total_atoms	1864
n_residues	240
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	53.4 Å
rg_real	17.51 Å
rg_real_error	0.22 Å
i0_real	2.4520e+07
i0_real_error	2.6480e+05
rg_reciprocal	17.53 Å
i0_reciprocal	24520000.0000
total_estimate	0.8272
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	52.7 Å
skewness	0.128
kurtosis	-0.453
angular_range	— – 0.4500 Å⁻¹
current_alpha	0.0000
highest_alpha	6081000.0000
n_real_points	76
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.922; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.984; Smooth: 0.000

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (6)

Entity 1 polymer

description	ELASTASE
formula_weight	25928.0 kDa
ec_number	3.4.21.36
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2030

VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN

Source

organism	Sus scrofa
common_name	pig
ncbi_taxonomy_id	9823

Entity 2 non-polymer

description	6-ammonio-N-(trifluoroacetyl)-L-norleucyl-N-[4-(1-methylethyl)phenyl]-L-prolinamide
formula_weight	457.5 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	CALCIUM ION
formula_weight	40.1 kDa
src_method	syn
entity_count	1

Entity 4 non-polymer

description	SULFATE ION
formula_weight	96.1 kDa
src_method	syn
entity_count	1

Entity 5 non-polymer

description	ACETIC ACID
formula_weight	60.1 kDa
src_method	syn
entity_count	1

Entity 6 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	166

▶

6. Citations (7)

Analogous inhibitors of elastase do not always bind analogously.

Nat.Struct.Biol. (1994)

PMID: 7656008 · DOI: 10.1038/nsb0194-55 PRIMARY

Interaction of the Peptide Cf3-Leu-Ala-Nh-C6H4-Cf3 (Tfla) with Porcine Pancreatic Elastase. X-Ray Studies at 1.8 Angstroms

J.Mol.Recog. (1990)

Structure of Native Porcine Pancreatic Elastase at 1.65 Angstroms Resolution

Acta Crystallogr.,Sect.B (1988)

Structure of the Product Complex of Acetyl-Ala-Pro-Ala with Porcine Pancreatic Elastase at 1.65 Angstroms Resolution

J.Mol.Biol. (1986)

Crystallographic Study of the Binding of a Tri-Fluoroacetyl Dipeptide Anilide Inhibitor with Elastase

J.Mol.Biol. (1982)

The Indirect Mechanism of Action of the Trifluoroacetyl Peptides on Elastase

Eur.J.Biochem. (1980)

;The Atomic Structure of Crystalline Porcine Pancreatic Elastase at 2.5 Angstroms Resolution. Comparisons with the Structure of Alpha-Chymotrypsin ;

J.Mol.Biol. (1978)

▶

length_a	52.370 Å
length_b	57.710 Å
length_c	75.430 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 21 21 21
int_tables_number	19
crystal_system	—

resolution	2.000 Å
resolution_low	10.000 Å
r_factor	0.1850
r_work	0.1850
r_free	—

fit	/app/data/saxs_computation/el/1ela/1ela.fit
pddf	/app/data/pr_computation/el/1ela/1ela.pr.out
profile	/app/data/saxs_computation/el/1ela/1ela.dat

Analogous inhibitors of elastase do not always bind analogously

SAXS Profile

P(r) Distribution