SAXSdb — 8gmo

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mature major capsid protein

Tequatrovirus T4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 980	Mature capsid vertex protein × 50 （P19896）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 98	Mature capsid vertex protein × 5 （P19896）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 98	Mature capsid vertex protein × 5 （P19896）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPSH_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–465； UniProt 66–521 Author chain 1； PDBConstruct 1–465； UniProt 66–521 Author chain 2； PDBConstruct 1–465； UniProt 66–521 Author chain 3； PDBConstruct 1–465； UniProt 66–521 Author chain 4； PDBConstruct 1–465； UniProt 66–521 Author chain 5； PDBConstruct 1–465； UniProt 66–521 Author chain 6； PDBConstruct 1–465； UniProt 66–521 Author chain 7； PDBConstruct 1–465； UniProt 66–521 Author chain 8； PDBConstruct 1–465； UniProt 66–521 Author chain 9； PDBConstruct 1–465； UniProt 66–521 Author chain AA； PDBConstruct 1–465； UniProt 66–521 Author chain AB； PDBConstruct 1–465； UniProt 66–521 Author chain AC； PDBConstruct 1–465； UniProt 66–521 Author chain AD； PDBConstruct 1–465； UniProt 66–521 Author chain AE； PDBConstruct 1–465； UniProt 66–521 Author chain AF； PDBConstruct 1–465； UniProt 66–521 Author chain AG； PDBConstruct 1–465； UniProt 66–521 Author chain AH； PDBConstruct 1–465； UniProt 66–521 Author chain AI； PDBConstruct 1–465； UniProt 66–521 Author chain AJ； PDBConstruct 1–465； UniProt 66–521 Author chain AK； PDBConstruct 1–465； UniProt 66–521 Author chain AL； PDBConstruct 1–465； UniProt 66–521 Author chain AM； PDBConstruct 1–465； UniProt 66–521 Author chain AN； PDBConstruct 1–465； UniProt 66–521 Author chain AO； PDBConstruct 1–465； UniProt 66–521 Author chain AP； PDBConstruct 1–465； UniProt 66–521 Author chain AQ； PDBConstruct 1–465； UniProt 66–521 Author chain AR； PDBConstruct 1–465； UniProt 66–521 Author chain AS； PDBConstruct 1–465； UniProt 66–521 Author chain AT； PDBConstruct 1–465； UniProt 66–521 Author chain AU； PDBConstruct 1–465； UniProt 66–521 Author chain AV； PDBConstruct 1–465； UniProt 66–521 Author chain AW； PDBConstruct 1–465； UniProt 66–521 Author chain AX； PDBConstruct 1–465； UniProt 66–521 Author chain AY； PDBConstruct 1–465； UniProt 66–521 Author chain AZ； PDBConstruct 1–465； UniProt 66–521 Author chain Aa； PDBConstruct 1–465； UniProt 66–521 Author chain Ab； PDBConstruct 1–465； UniProt 66–521 Author chain Ac； PDBConstruct 1–465； UniProt 66–521 Author chain Ad； PDBConstruct 1–465； UniProt 66–521 Author chain Ae； PDBConstruct 1–465； UniProt 66–521 Author chain Af； PDBConstruct 1–465； UniProt 66–521 Author chain Ag； PDBConstruct 1–465； UniProt 66–521 Author chain Ah； PDBConstruct 1–465； UniProt 66–521 Author chain Ai； PDBConstruct 1–465； UniProt 66–521 Author chain Aj； PDBConstruct 1–465； UniProt 66–521 Author chain Ak； PDBConstruct 1–465； UniProt 66–521 Author chain Al； PDBConstruct 1–465； UniProt 66–521 Author chain Am； PDBConstruct 1–465； UniProt 66–521 Author chain G； PDBConstruct 1–465； UniProt 66–521 Author chain H； PDBConstruct 1–465； UniProt 66–521 Author chain J； PDBConstruct 1–465； UniProt 66–521 Author chain K； PDBConstruct 1–465； UniProt 66–521 Author chain L； PDBConstruct 1–465； UniProt 66–521 Author chain M； PDBConstruct 1–465； UniProt 66–521 Author chain N； PDBConstruct 1–465； UniProt 66–521 Author chain O； PDBConstruct 1–465； UniProt 66–521 Author chain P； PDBConstruct 1–465； UniProt 66–521 Author chain Q； PDBConstruct 1–465； UniProt 66–521 Author chain R； PDBConstruct 1–465； UniProt 66–521 Author chain S； PDBConstruct 1–465； UniProt 66–521 Author chain T； PDBConstruct 1–465； UniProt 66–521 Author chain U； PDBConstruct 1–465； UniProt 66–521 Author chain V； PDBConstruct 1–465； UniProt 66–521 Author chain W； PDBConstruct 1–465； UniProt 66–521 Author chain X； PDBConstruct 1–465； UniProt 66–521 Author chain Y； PDBConstruct 1–465； UniProt 66–521 Author chain Z； PDBConstruct 1–465； UniProt 66–521 Author chain b； PDBConstruct 1–465； UniProt 66–521 Author chain c； PDBConstruct 1–465； UniProt 66–521 Author chain d； PDBConstruct 1–465； UniProt 66–521 Author chain e； PDBConstruct 1–465； UniProt 66–521 Author chain f； PDBConstruct 1–465； UniProt 66–521 Author chain g； PDBConstruct 1–465； UniProt 66–521 Author chain h； PDBConstruct 1–465； UniProt 66–521 Author chain i； PDBConstruct 1–465； UniProt 66–521 Author chain j； PDBConstruct 1–465； UniProt 66–521 Author chain k； PDBConstruct 1–465； UniProt 66–521 Author chain l； PDBConstruct 1–465； UniProt 66–521 Author chain m； PDBConstruct 1–465； UniProt 66–521 Author chain n； PDBConstruct 1–465； UniProt 66–521 Author chain o； PDBConstruct 1–465； UniProt 66–521 Author chain p； PDBConstruct 1–465； UniProt 66–521 Author chain q； PDBConstruct 1–465； UniProt 66–521 Author chain r； PDBConstruct 1–465； UniProt 66–521 Author chain s； PDBConstruct 1–465； UniProt 66–521 Author chain t； PDBConstruct 1–465； UniProt 66–521 Author chain u； PDBConstruct 1–465； UniProt 66–521 Author chain v； PDBConstruct 1–465； UniProt 66–521 Author chain w； PDBConstruct 1–465； UniProt 66–521 Author chain x； PDBConstruct 1–465； UniProt 66–521 Author chain y； PDBConstruct 1–465； UniProt 66–521 Author chain z； PDBConstruct 1–465； UniProt 66–521

Mature capsid vertex protein

Tequatrovirus T4

UniProt P19896

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 980	Mature major capsid protein × 930 （P04535）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 98	Mature major capsid protein × 93 （P04535）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 98	Mature major capsid protein × 93 （P04535）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPSP_BPT4
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–415； UniProt 11–425 Author chain B； PDBConstruct 1–415； UniProt 11–425 Author chain C； PDBConstruct 1–415； UniProt 11–425 Author chain D； PDBConstruct 1–415； UniProt 11–425 Author chain a； PDBConstruct 1–415； UniProt 11–425

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8gmo
Deposition date deposition_date	2023-03-26
Structure title title	Bacteriophage T4 capsid shell containing 9DE insertions into the gp23* major capsid protein subunits
Keywords keywords	Bacteriophage T4, capsid shell, phage display, decorated capsid, phage head, VIRUS LIKE PARTICLE; VIRUS LIKE PARTICLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8gmo__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8gmo__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8gmo__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	465.80 Å
Total Rg	465.80 Å
Atom count	3413790
Residues	452940
Excluded volume	60462000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8gmo__assembly_1__model_1`	980-meric （980）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8gmo__assembly_2__model_1`	98-meric （98）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`8gmo__assembly_3__model_1`	98-meric （98）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Mature major capsid protein
Molecular weight formula_weight	49790.7 kDa
Source method src_method	man
Copy count entity_count	93

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;0,1,2,3,4,5,6,7,8,9,AA,AB,AC,AD,AE,AF,AG,AH,AI,AJ,AK,AL,AM,AN,AO,AP,AQ,AR,AS,AT,AU,AV,AW,AX,AY,AZ,Aa,Ab,Ac,Ad,Ae,Af,Ag,Ah,Ai,Aj,Ak,Al,Am,G,H,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x,y,z ;
Atom count atom_count	341379

AEIGGDHGYNATNIAAGQTSGAVTQIGPAVMGMVRRAIPNLIAFDICGVQPMNSPTGQVFALRAVYGKDPVAAGAKEAFHPMYGPDAMFSGQGAAKKFPALAASTQTTVGDIYTHFFQETGTVYLQASVQVTIDAGDEDEDEDEDATDAAKLDAEIKKQMEAGALVEIAEGMATSIAELQEGFNGSTDNPWNEMGFRIDKQVIEAKSRQLKAAYSIELAQDLRAVHGMDADAELSGILATEIMLEINREVVDWINYSAQVGKSGMTLTPGSKAGVFDFQDPIDIRGARWAGESFKALLFQIDKEAVEIARQTGRGEGNFIIASRNVVNVLASVDTGISYAAQGLATGFSTDTTKSVFAGVLGGKYRVYIDQYAKQDYFTVGYKGPNEMDAGIYYAPYVALTPLRGSDPKNFQPVMGFKTRYGIGINPFAESAAQAPASRIQSGMPSILNSLGKNAYFRRVYVKGI

Source Source

Source organism organism	Tequatrovirus T4
NCBI taxonomy ID ncbi_taxonomy_id	10665
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Mature capsid vertex protein
Molecular weight formula_weight	45594.4 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,a

STTTNSNSIGRPNLVALTRATTKLIYSDIVATQRTNQPVAAFYGIKYLNPDNEFTFKTGATYAGEAGYVDREQITELTEESKLTLNKGDLFKYNNIVYKVLEDTPFATIEESDLELALQIAIVLLKVRLFSDAASTSKFESSDSEIADARFQINKWQTAVKSRKLKTGITVELAQDLEANGFDAPNFLEDLLATEMADEINKDILQSLITVSKRYKVTGITDSGFIDLSYASAPEAGRSLYRMVCEMVSHIQKESTYTATFCVASARAAAILAASGWLKHKPEDDKYLSQNAYGFLANGLPLYCDTNSPLDYVIVGVVENIGEKEIVGSIFYAPYTEGLDLDDPEHVGAFKVVVDPESLQPSIGLLVRYALSANPYTVAKDEKEARIIDGGDMDKMAGRSDLSVLLGVKLPKIII

Source Source

Source organism organism	Tequatrovirus T4
NCBI taxonomy ID ncbi_taxonomy_id	10665
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	70340

Bacteriophage T4 capsid shell containing 9DE insertions into the gp23* major capsid protein subunits

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mature major capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Mature capsid vertex protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8gmo__assembly_1__model_1

8gmo__assembly_1__model_1 | I(q)

8gmo__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Bacteriophage T4 capsid shell containing 9DE insertions into the gp23* major capsid protein subunits

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mature major capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mature capsid vertex protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8gmo__assembly_1__model_1

8gmo__assembly_1__model_1 | I(q)

8gmo__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)