8k35

Structure of the bacteriophage lambda tail tip complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tip attachment protein J

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Tail tip protein L × 3 （P03738） Tail tip protein M × 6 （P03737） Tail tip assembly protein I × 3 （P03730） Tail tube protein × 6 （P03733） Tape measure protein × 3 （P03736） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIPJ_LAMBD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1132； UniProt 1–1132 Author chain B； PDBConstruct 1–1132； UniProt 1–1132 Author chain I； PDBConstruct 1–1132； UniProt 1–1132

Tail tip protein L

OrganismNot specified

UniProt P03738

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Tip attachment protein J × 3 （P03749） Tail tip protein M × 6 （P03737） Tail tip assembly protein I × 3 （P03730） Tail tube protein × 6 （P03733） Tape measure protein × 3 （P03736） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIPL_LAMBD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–232； UniProt 1–232 Author chain J； PDBConstruct 1–232； UniProt 1–232 Author chain N； PDBConstruct 1–232； UniProt 1–232

Tail tip protein M

OrganismNot specified

UniProt P03737

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） Tail tip assembly protein I × 3 （P03730） Tail tube protein × 6 （P03733） Tape measure protein × 3 （P03736） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIPM_LAMBD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–109； UniProt 1–109 Author chain D； PDBConstruct 1–109； UniProt 1–109 Author chain E； PDBConstruct 1–109； UniProt 1–109 Author chain F； PDBConstruct 1–109； UniProt 1–109 Author chain H； PDBConstruct 1–109； UniProt 1–109 Author chain O； PDBConstruct 1–109； UniProt 1–109

Tail tip assembly protein I

OrganismNot specified

UniProt P03730

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） Tail tip protein M × 6 （P03737） Tail tube protein × 6 （P03733） Tape measure protein × 3 （P03736） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIPI_LAMBD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–223； UniProt 1–223 Author chain Q； PDBConstruct 1–223； UniProt 1–223 Author chain x； PDBConstruct 1–223； UniProt 1–223

Tail tube protein

OrganismNot specified

UniProt P03733

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） Tail tip protein M × 6 （P03737） Tail tip assembly protein I × 3 （P03730） Tape measure protein × 3 （P03736） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TUBE_LAMBD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain L； PDBConstruct 1–246； UniProt 1–246 Author chain R； PDBConstruct 1–246； UniProt 1–246 Author chain T； PDBConstruct 1–246； UniProt 1–246 Author chain U； PDBConstruct 1–246； UniProt 1–246 Author chain V； PDBConstruct 1–246； UniProt 1–246 Author chain W； PDBConstruct 1–246； UniProt 1–246

Tape measure protein

OrganismNot specified

UniProt P03736

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） Tail tip protein M × 6 （P03737） Tail tip assembly protein I × 3 （P03730） Tail tube protein × 6 （P03733） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TMP_LAMBD
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain M； PDBConstruct 1–853； UniProt 1–853 Author chain P； PDBConstruct 1–853； UniProt 1–853 Author chain S； PDBConstruct 1–853； UniProt 1–853

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8k35
Deposition date deposition_date	2023-07-14
Structure title title	Structure of the bacteriophage lambda tail tip complex
Keywords keywords	Complex, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8k35__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8k35__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8k35__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	67.55 Å
Rg (electron density)	68.83 Å
Total Rg	68.44 Å
Atom count	40353
Residues	5184
Excluded volume	712260 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8k35__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Tip attachment protein J
Molecular weight formula_weight	124550.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,A,B
Atom count atom_count	40353

MGKGSSKGHTPREAKDNLKSTQLLSVIDAISEGPIEGPVDGLKSVLLNSTPVLDTEGNTNISGVTVVFRAGEQEQTPPEGFESSGSETVLGTEVKYDTPITRTITSANIDRLRFTFGVQALVETTSKGDRNPSEVRLLVQIQRNGGWVTEKDITIKGKTTSQYLASVVMGNLPPRPFNIRMRRMTPDSTTDQLQNKTLWSSYTEIIDVKQCYPNTALVGVQVDSEQFGSQQVSRNYHLRGRILQVPSNYNPQTRQYSGIWDGTFKPAYSNNMAWCLWDMLTHPRYGMGKRLGAADVDKWALYVIGQYCDQSVPDGFGGTEPRITCNAYLTTQRKAWDVLSDFCSAMRCMPVWNGQTLTFVQDRPSDKTWTYNRSNVVMPDDGAPFRYSFSALKDRHNAVEVNWIDPNNGWETATELVEDTQAIARYGRNVTKMDAFGCTSRGQAHRAGLWLIKTELLETQTVDFSVGAEGLRHVPGDVIEICDDDYAGISTGGRVLAVNSQTRTLTLDREITLPSSGTALISLVDGSGNPVSVEVQSVTDGVKVKVSRVPDGVAEYSVWELKLPTLRQRLFRCVSIRENDDGTYAITAVQHVPEKEAIVDNGAHFDGEQSGTVNGVTPPAVQHLTAEVTADSGEYQVLARWDTPKVVKGVSFLLRLTVTADDGSERLVSTARTTETTYRFTQLALGNYRLTVRAVNAWGQQGDPASVSFRIAAPAAPSRIELTPGYFQITATPHLAVYDPTVQFEFWFSEKQIADIRQVETSTRYLGTALYWIAASINIKPGHDYYFYIRSVNTVGKSAFVEAVGRASDDAEGYLDFFKGKITESHLGKELLEKVELTEDNASRLEEFSKEWKDASDKWNAMWAVKIEQTKDGKHYVAGIGLSMEDTEEGKLSQFLVAANRIAFIDPANGNETPMFVAQGNQIFMNDVFLKRLTAPTITSGGNPPAFSLTPDGKLTAKNADISGSVNANSGTLSNVTIAENCTINGTLRAEKIVGDIVKAASAAFPRQRESSVDWPSGTRTVTVTDDHPFDRQIVVLPLTFRGSKRTVSGRTTYSMCYLKVLMNGAVIYDGAANEAVQVFSRIVDMPAGRGNVILTFTLTSTRHSADIPPYTFASDVQVMVIKKQALGISVV

Entity 2 Entity 2 polymer

Description description	Tail tip protein L
Molecular weight formula_weight	25730.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,G,N

MQDIRQETLNECTRAEQSASVVLWEIDLTEVGGERYFFCNEQNEKGEPVTWQGRQYQPYPIQGSGFELNGKGTSTRPTLTVSNLYGMVTGMAEDMQSLVGGTVVRRKVYARFLDAVNFVNGNSYADPEQEVISRWRIEQCSELSAVSASFVLSTPTETDGAVFPGRIMLANTCTWTYRGDECGYSGPAVADEYDQPTSDITKDKCSKCLSGCKFRNNVGNFGGFLSINKLSQ

Entity 3 Entity 3 polymer

Description description	Tail tip protein M
Molecular weight formula_weight	12547.4 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,O,C,E,D,F

MKTFRWKVKPGMDVASVPSVRKVRFGDGYSQRAPAGLNANLKTYSVTLSVPREEATVLESFLEEHGGWKSFLWTPPYEWRQIKVTCAKWSSRVSMLRVEFSAEFEQVVN

Entity 4 Entity 4 polymer

Description description	Tail tip assembly protein I
Molecular weight formula_weight	23146.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x,K,Q

MAATHTLPLASPGMARICLYGDLQRFGRRIDLRVKTGAEAIRALATQLPAFRQKLSDGWYQVRIAGRDVSTSGLTAQLHETLPDGAVIHIVPRVAGAKSGGVFQIVLGAAAIAGSFFTAGATLAAWGAAIGAGGMTGILFSLGASMVLGGVAQMLAPKARTPRIQTTDNGKQNTYFSSLDNMVAQGNVLPVLYGEMRVGSRVVSQEISTADEGDGGQVVVIGR

Entity 5 Entity 5 polymer

Description description	Tail tube protein
Molecular weight formula_weight	25831.8 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,R,T,U,V,W

MPVPNPTMPVKGAGTTLWVYKGSGDPYANPLSDVDWSRLAKVKDLTPGELTAESYDDSYLDDEDADWTATGQGQKSAGDTSFTLAWMPGEQGQQALLAWFNEGDTRAYKIRFPNGTVDVFRGWVSSIGKAVTAKEVITRTVKVTNVGRPSMAEDRSTVTAATGMTVTPASTSVVKGQSTTLTVAFQPEGVTDKSFRAVSADKTKATVSVSGMTITVNGVAAGKVNIPVVSGNGEFAAVAEITVTAS

Entity 6 Entity 6 polymer

Description description	Tape measure protein
Molecular weight formula_weight	92393.4 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,M,S

MAEPVGDLVVDLSLDAARFDEQMARVRRHFSGTESDAKKTAAVVEQSLSRQALAAQKAGISVGQYKAAMRMLPAQFTDVATQLAGGQSPWLILLQQGGQVKDSFGGMIPMFRGLAGAITLPMVGATSLAVATGALAYAWYQGNSTLSDFNKTLVLSGNQAGLTADRMLVLSRAGQAAGLTFNQTSESLSALVKAGVSGEAQIASISQSVARFSSASGVEVDKVAEAFGKLTTDPTSGLTAMARQFHNVSAEQIAYVAQLQRSGDEAGALQAANEAATKGFDDQTRRLKENMGTLETWADRTARAFKSMWDAVLDIGRPDTAQEMLIKAEAAYKKADDIWNLRKDDYFVNDEARARYWDDREKARLALEAARKKAEQQTQQDKNAQQQSDTEASRLKYTEEAQKAYERLQTPLEKYTARQEELNKALKDGKILQADYNTLMAAAKKDYEATLKKPKQSSVKVSAGDRQEDSAHAALLTLQAELRTLEKHAGANEKISQQRRDLWKAESQFAVLEEAAQRRQLSAQEKSLLAHKDETLEYKRQLAALGDKVTYQERLNALAQQADKFAQQQRAKRAAIDAKSRGLTDRQAEREATEQRLKEQYGDNPLALNNVMSEQKKTWAAEDQLRGNWMAGLKSGWSEWEESATDSMSQVKSAATQTFDGIAQNMAAMLTGSEQNWRSFTRSVLSMMTEILLKQAMVGIVGSIGSAIGGAVGGGASASGGTAIQAAAAKFHFATGGFTGTGGKYEPAGIVHRGEFVFTKEATSRIGVGNLYRLMRGYATGGYVGTPGSMADSRSQASGTFEQNNHVVINNDGTNGQIGPAALKAVYDMARKGARDEIQTQMRDGGLFSGGGR

Entity 7 Entity 7 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.44 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	54385

Structure of the bacteriophage lambda tail tip complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tip attachment protein J

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tip protein L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tip protein M

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tip assembly protein I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tube protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tape measure protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8k35__assembly_1__model_1

8k35__assembly_1__model_1 | I(q)

8k35__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 non-polymer

7. Citations (1)