9e7m

In situ cryoEM structure of bacteriophage Ur-lambda tail tip complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tape measure protein

Escherichia phage Lambda

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Tail tip assembly protein I × 2 （P03730） Tail tip assembly protein I × 1 （P03730） Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） Tail fiber protein × 12 （P03764） Tail tip protein M × 6 （P03737） Tail tube protein × 6 （P03733） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TMP_LAMBD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Ha； PDBConstruct 1–32； UniProt 818–849 Author chain Hb； PDBConstruct 1–32； UniProt 818–849 Author chain Hc； PDBConstruct 1–32； UniProt 818–849

Tail tip assembly protein I

Escherichia phage Lambda

UniProt P03730

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Tape measure protein × 3 （P03736） Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） Tail fiber protein × 12 （P03764） Tail tip protein M × 6 （P03737） Tail tube protein × 6 （P03733） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIPI_LAMBD
Isoform	—
PDB entities	2, 3
Chains and sequence ranges	Author chain Ia； PDBConstruct 1–90； UniProt 133–222 Author chain Ib； PDBConstruct 1–90； UniProt 133–222 Author chain Ic； PDBConstruct 1–90； UniProt 133–222

Tip attachment protein J

Escherichia phage Lambda

UniProt P03749

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Tape measure protein × 3 （P03736） Tail tip assembly protein I × 2 （P03730） Tail tip assembly protein I × 1 （P03730） Tail tip protein L × 3 （P03738） Tail fiber protein × 12 （P03764） Tail tip protein M × 6 （P03737） Tail tube protein × 6 （P03733） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIPJ_LAMBD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Ja； PDBConstruct 1–835； UniProt 1–835 Author chain Jb； PDBConstruct 1–835； UniProt 1–835 Author chain Jc； PDBConstruct 1–835； UniProt 1–835

Tail tip protein L

Escherichia phage Lambda

UniProt P03738

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Tape measure protein × 3 （P03736） Tail tip assembly protein I × 2 （P03730） Tail tip assembly protein I × 1 （P03730） Tip attachment protein J × 3 （P03749） Tail fiber protein × 12 （P03764） Tail tip protein M × 6 （P03737） Tail tube protein × 6 （P03733） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIPL_LAMBD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain La； PDBConstruct 1–232； UniProt 1–232 Author chain Lb； PDBConstruct 1–232； UniProt 1–232 Author chain Lc； PDBConstruct 1–232； UniProt 1–232

Tail fiber protein

Escherichia phage Lambda

UniProt P03764

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Tape measure protein × 3 （P03736） Tail tip assembly protein I × 2 （P03730） Tail tip assembly protein I × 1 （P03730） Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） Tail tip protein M × 6 （P03737） Tail tube protein × 6 （P03733） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FIBER_LAMBD
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain Ta； PDBConstruct 1–94； UniProt 1–94 Author chain Tb； PDBConstruct 1–94； UniProt 1–94 Author chain Tc； PDBConstruct 1–94； UniProt 1–94 Author chain Td； PDBConstruct 1–94； UniProt 1–94 Author chain Te； PDBConstruct 1–94； UniProt 1–94 Author chain Tf； PDBConstruct 1–94； UniProt 1–94 Author chain Tg； PDBConstruct 1–94； UniProt 1–94 Author chain Th； PDBConstruct 1–94； UniProt 1–94 Author chain Ti； PDBConstruct 1–94； UniProt 1–94 Author chain Tj； PDBConstruct 1–94； UniProt 1–94 Author chain Tk； PDBConstruct 1–94； UniProt 1–94 Author chain Tl； PDBConstruct 1–94； UniProt 1–94

Tail tip protein M

Escherichia phage Lambda

UniProt P03737

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Tape measure protein × 3 （P03736） Tail tip assembly protein I × 2 （P03730） Tail tip assembly protein I × 1 （P03730） Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） Tail fiber protein × 12 （P03764） Tail tube protein × 6 （P03733） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIPM_LAMBD
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Ma； PDBConstruct 1–109； UniProt 1–109 Author chain Mb； PDBConstruct 1–109； UniProt 1–109 Author chain Mc； PDBConstruct 1–109； UniProt 1–109 Author chain Md； PDBConstruct 1–109； UniProt 1–109 Author chain Me； PDBConstruct 1–109； UniProt 1–109 Author chain Mf； PDBConstruct 1–109； UniProt 1–109

Tail tube protein

Escherichia phage Lambda

UniProt P03733

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Tape measure protein × 3 （P03736） Tail tip assembly protein I × 2 （P03730） Tail tip assembly protein I × 1 （P03730） Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） Tail fiber protein × 12 （P03764） Tail tip protein M × 6 （P03737） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TUBE_LAMBD
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Va； PDBConstruct 1–152； UniProt 3–157 Author chain Vb； PDBConstruct 1–152； UniProt 3–157 Author chain Vc； PDBConstruct 1–152； UniProt 3–157 Author chain Vd； PDBConstruct 1–152； UniProt 3–157 Author chain Ve； PDBConstruct 1–152； UniProt 3–157 Author chain Vf； PDBConstruct 1–152； UniProt 3–157

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9e7m
Deposition date deposition_date	2024-11-03
Structure title title	In situ cryoEM structure of bacteriophage Ur-lambda tail tip complex
Keywords keywords	bacteriophage, tail tip complex, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9e7m__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9e7m__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9e7m__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	68.64 Å
Rg (electron density)	69.55 Å
Total Rg	69.38 Å
Atom count	48257
Residues	6260
Excluded volume	851970 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9e7m__assembly_1__model_1`	36-meric （36）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Tape measure protein
Molecular weight formula_weight	3472.0 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ha,Hb,Hc
Atom count atom_count	48257

IGPAALKAVYDMARKGARDEIQTQMRDGGLFS

Source Source

Source organism organism	Escherichia phage Lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli K-12

Entity 2 Entity 2 polymer

Description description	Tail tip assembly protein I
Molecular weight formula_weight	9322.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ia,Ib

GGMTGILFSLGASMVLGGVAQMLAPKARTPRIQTTDNGKQNTYFSSLDNMVAQGNVLPVLYGEMRVGSRVVSQEISTADEGDGGQVVVIG

Source Source

Source organism organism	Escherichia phage Lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli K-12

Entity 3 Entity 3 polymer

Description description	Tail tip assembly protein I
Molecular weight formula_weight	9308.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ic

GGMTGVLFSLGASMVLGGVAQMLAPKARTPRIQTTDNGKQNTYFSSLDNMVAQGNVLPVLYGEMRVGSRVVSQEISTADEGDGGQVVVIG

Source Source

Source organism organism	Escherichia phage Lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli K-12

Entity 4 Entity 4 polymer

Description description	Tip attachment protein J
Molecular weight formula_weight	92362.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ja,Jb,Jc

MGKGSSKGHTPREAKDNLKSTQLLSVIDAISEGPIEGPVDGLKSVLLNSTPVLDTEGNTNISGVTVVFRAGEQEQTPPEGFESSGSETVLGTEVKYDTPITRTITSANIDRLRFTFGVQALVETTSKGDRNPSEVRLLVQIQRNGGWVTEKDITIKGKTTSQYLASVVMGNLPPRPFNIRMRRMTPDSTTDQLQNKTLWSSYTEIIDVKQCYPNTALVGVQVDSEQFGSQQVSRNYHLRGRILQVPSNYNPQTRQYSGIWDGTFKPAYSNNMAWCLWDMLTHPRYGMGKRLGAADVDKWALYVIGQYCDQSVPDGFGGTEPRITCNAYLTTQRKAWDVLSDFCSAMRCMPVWNGQTLTFVQDRPSDKTWTYNRSNVVMPDDGAPFRYSFSALKDRHNAVEVNWIDPNNGWETATELVEDTQAIARYGRNVTKMDAFGCTSRGQAHRAGLWLIKTELLETQTVDFSVGAEGLRHVPGDVIEICDDDYAGISTGGRVLAVNSQTRTLTLDREITLPSSGTALISLVDGSGNPVSVEVQSVTDGVKVKVSRVPDGVAEYSVWELKLPTLRQRLFRCVSIRENDDGTYAITAVQHVPEKEAIVDNGAHFDGEQSGTVNGVTPPAVQHLTAEVTADSGEYQVLARWDTPKVVKGVSFLLRLTVTADDGSERLVSTARTTETTYRFTQLALGNYRLTVRAVNAWGQQGDPASVSFRIAAPAAPSRIELTPGYFQITATPHLAVYDPTVQFEFWFSEKQIADIRQVETSTRYLGTALYWIAASINIKPGHDYYFYIRSVNTVGKSAFVEAVGRASDDAEGYLDFFKGKITESHLGKELLEKV

Source Source

Source organism organism	Escherichia phage Lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli K-12

Entity 5 Entity 5 polymer

Description description	Tail tip protein L
Molecular weight formula_weight	25730.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Lc,Lb,La

MQDIRQETLNECTRAEQSASVVLWEIDLTEVGGERYFFCNEQNEKGEPVTWQGRQYQPYPIQGSGFELNGKGTSTRPTLTVSNLYGMVTGMAEDMQSLVGGTVVRRKVYARFLDAVNFVNGNSYADPEQEVISRWRIEQCSELSAVSASFVLSTPTETDGAVFPGRIMLANTCTWTYRGDECGYSGPAVADEYDQPTSDITKDKCSKCLSGCKFRNNVGNFGGFLSINKLSQ

Source Source

Source organism organism	Escherichia phage Lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli K-12

Entity 6 Entity 6 polymer

Description description	Tail fiber protein
Molecular weight formula_weight	10092.3 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ta,Tb,Tc,Td,Te,Tf,Tg,Tl,Th,Ti,Tj,Tk

MAVKISGVLKDGTGKPVQNCTIQLKARRNSTTVVVNTVGSENPDEAGRYSMDVEYGQYSVILQVDGFPPSHAGTITVYEDSQPGTLNDFLCAMT

Source Source

Source organism organism	Escherichia phage Lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli K-12

Entity 7 Entity 7 polymer

Description description	Tail tip protein M
Molecular weight formula_weight	12547.4 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ma,Mb,Mc,Md,Me,Mf

MKTFRWKVKPGMDVASVPSVRKVRFGDGYSQRAPAGLNANLKTYSVTLSVPREEATVLESFLEEHGGWKSFLWTPPYEWRQIKVTCAKWSSRVSMLRVEFSAEFEQVVN

Source Source

Source organism organism	Escherichia phage Lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli K-12

Entity 8 Entity 8 polymer

Description description	Tail tube protein
Molecular weight formula_weight	16540.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Va,Vb,Vc,Vd,Ve,Vf

VPNPTMPVKGAGTTLWVYKGSGDPYANPLSDVDWSRLAKVKDLTPGELTAESYDDSYLDDEDADWTATGQGQKSAGDTSFTLAWMPGEQGQQALLAWFNEGDTRAYKIRFPNGTVDVFRGWVSSIGKAVTVITRTVKVTNVGRPSMAEDRST

Source Source

Source organism organism	Escherichia phage Lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli K-12

Entity 9 Entity 9 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.37 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	6517

In situ cryoEM structure of bacteriophage Ur-lambda tail tip complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tape measure protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tip assembly protein I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tip attachment protein J

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tip protein L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail fiber protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tip protein M

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tube protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9e7m__assembly_1__model_1

9e7m__assembly_1__model_1 | I(q)

9e7m__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source