9eg1

COP9 signalosome deneddylation complex with cullin-5

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

COP9 signalosome complex subunit 2

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	COP9 signalosome complex subunit 4 × 1 （Q9BT78） COP9 signalosome complex subunit 5 × 1 （Q92905） COP9 signalosome complex subunit 6 × 1 （Q7L5N1） COP9 signalosome complex subunit 7b × 1 （Q9H9Q2） COP9 signalosome complex subunit 8 × 1 （Q99627） Cullin-5 × 1 （Q93034） RING-box protein 2 × 1 （Q9UBF6） COP9 signalosome complex subunit 1 × 1 （Q13098） COP9 signalosome complex subunit 3 × 1 （Q9UNS2） NEDD8 × 1 （Q15843） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–443； UniProt 1–443

COP9 signalosome complex subunit 4

Homo sapiens

UniProt Q9BT78

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	COP9 signalosome complex subunit 2 × 1 （P61201） COP9 signalosome complex subunit 5 × 1 （Q92905） COP9 signalosome complex subunit 6 × 1 （Q7L5N1） COP9 signalosome complex subunit 7b × 1 （Q9H9Q2） COP9 signalosome complex subunit 8 × 1 （Q99627） Cullin-5 × 1 （Q93034） RING-box protein 2 × 1 （Q9UBF6） COP9 signalosome complex subunit 1 × 1 （Q13098） COP9 signalosome complex subunit 3 × 1 （Q9UNS2） NEDD8 × 1 （Q15843） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN4_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–406； UniProt 1–406

COP9 signalosome complex subunit 5

Homo sapiens

UniProt Q92905

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	COP9 signalosome complex subunit 2 × 1 （P61201） COP9 signalosome complex subunit 4 × 1 （Q9BT78） COP9 signalosome complex subunit 6 × 1 （Q7L5N1） COP9 signalosome complex subunit 7b × 1 （Q9H9Q2） COP9 signalosome complex subunit 8 × 1 （Q99627） Cullin-5 × 1 （Q93034） RING-box protein 2 × 1 （Q9UBF6） COP9 signalosome complex subunit 1 × 1 （Q13098） COP9 signalosome complex subunit 3 × 1 （Q9UNS2） NEDD8 × 1 （Q15843） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN5_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–334； UniProt 1–334

COP9 signalosome complex subunit 6

Homo sapiens

UniProt Q7L5N1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	COP9 signalosome complex subunit 2 × 1 （P61201） COP9 signalosome complex subunit 4 × 1 （Q9BT78） COP9 signalosome complex subunit 5 × 1 （Q92905） COP9 signalosome complex subunit 7b × 1 （Q9H9Q2） COP9 signalosome complex subunit 8 × 1 （Q99627） Cullin-5 × 1 （Q93034） RING-box protein 2 × 1 （Q9UBF6） COP9 signalosome complex subunit 1 × 1 （Q13098） COP9 signalosome complex subunit 3 × 1 （Q9UNS2） NEDD8 × 1 （Q15843） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN6_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 1–327； UniProt 1–327

COP9 signalosome complex subunit 7b

Homo sapiens

UniProt Q9H9Q2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	COP9 signalosome complex subunit 2 × 1 （P61201） COP9 signalosome complex subunit 4 × 1 （Q9BT78） COP9 signalosome complex subunit 5 × 1 （Q92905） COP9 signalosome complex subunit 6 × 1 （Q7L5N1） COP9 signalosome complex subunit 8 × 1 （Q99627） Cullin-5 × 1 （Q93034） RING-box protein 2 × 1 （Q9UBF6） COP9 signalosome complex subunit 1 × 1 （Q13098） COP9 signalosome complex subunit 3 × 1 （Q9UNS2） NEDD8 × 1 （Q15843） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN7B_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–264； UniProt 1–264

COP9 signalosome complex subunit 8

Homo sapiens

UniProt Q99627

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	COP9 signalosome complex subunit 2 × 1 （P61201） COP9 signalosome complex subunit 4 × 1 （Q9BT78） COP9 signalosome complex subunit 5 × 1 （Q92905） COP9 signalosome complex subunit 6 × 1 （Q7L5N1） COP9 signalosome complex subunit 7b × 1 （Q9H9Q2） Cullin-5 × 1 （Q93034） RING-box protein 2 × 1 （Q9UBF6） COP9 signalosome complex subunit 1 × 1 （Q13098） COP9 signalosome complex subunit 3 × 1 （Q9UNS2） NEDD8 × 1 （Q15843） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN8_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H； PDBConstruct 1–209； UniProt 1–209

Cullin-5

Homo sapiens

UniProt Q93034

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	COP9 signalosome complex subunit 2 × 1 （P61201） COP9 signalosome complex subunit 4 × 1 （Q9BT78） COP9 signalosome complex subunit 5 × 1 （Q92905） COP9 signalosome complex subunit 6 × 1 （Q7L5N1） COP9 signalosome complex subunit 7b × 1 （Q9H9Q2） COP9 signalosome complex subunit 8 × 1 （Q99627） RING-box protein 2 × 1 （Q9UBF6） COP9 signalosome complex subunit 1 × 1 （Q13098） COP9 signalosome complex subunit 3 × 1 （Q9UNS2） NEDD8 × 1 （Q15843） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CUL5_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain J； PDBConstruct 1–780； UniProt 1–780

RING-box protein 2

Homo sapiens

UniProt Q9UBF6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	COP9 signalosome complex subunit 2 × 1 （P61201） COP9 signalosome complex subunit 4 × 1 （Q9BT78） COP9 signalosome complex subunit 5 × 1 （Q92905） COP9 signalosome complex subunit 6 × 1 （Q7L5N1） COP9 signalosome complex subunit 7b × 1 （Q9H9Q2） COP9 signalosome complex subunit 8 × 1 （Q99627） Cullin-5 × 1 （Q93034） COP9 signalosome complex subunit 1 × 1 （Q13098） COP9 signalosome complex subunit 3 × 1 （Q9UNS2） NEDD8 × 1 （Q15843） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBX2_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain K； PDBConstruct 1–113； UniProt 1–113

COP9 signalosome complex subunit 1

Homo sapiens

UniProt Q13098

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	COP9 signalosome complex subunit 2 × 1 （P61201） COP9 signalosome complex subunit 4 × 1 （Q9BT78） COP9 signalosome complex subunit 5 × 1 （Q92905） COP9 signalosome complex subunit 6 × 1 （Q7L5N1） COP9 signalosome complex subunit 7b × 1 （Q9H9Q2） COP9 signalosome complex subunit 8 × 1 （Q99627） Cullin-5 × 1 （Q93034） RING-box protein 2 × 1 （Q9UBF6） COP9 signalosome complex subunit 3 × 1 （Q9UNS2） NEDD8 × 1 （Q15843） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN1_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain A； PDBConstruct 1–491； UniProt 1–491

COP9 signalosome complex subunit 3

Homo sapiens

UniProt Q9UNS2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	COP9 signalosome complex subunit 2 × 1 （P61201） COP9 signalosome complex subunit 4 × 1 （Q9BT78） COP9 signalosome complex subunit 5 × 1 （Q92905） COP9 signalosome complex subunit 6 × 1 （Q7L5N1） COP9 signalosome complex subunit 7b × 1 （Q9H9Q2） COP9 signalosome complex subunit 8 × 1 （Q99627） Cullin-5 × 1 （Q93034） RING-box protein 2 × 1 （Q9UBF6） COP9 signalosome complex subunit 1 × 1 （Q13098） NEDD8 × 1 （Q15843） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN3_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain C； PDBConstruct 1–423； UniProt 1–423

NEDD8

Homo sapiens

UniProt Q15843

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	COP9 signalosome complex subunit 2 × 1 （P61201） COP9 signalosome complex subunit 4 × 1 （Q9BT78） COP9 signalosome complex subunit 5 × 1 （Q92905） COP9 signalosome complex subunit 6 × 1 （Q7L5N1） COP9 signalosome complex subunit 7b × 1 （Q9H9Q2） COP9 signalosome complex subunit 8 × 1 （Q99627） Cullin-5 × 1 （Q93034） RING-box protein 2 × 1 （Q9UBF6） COP9 signalosome complex subunit 1 × 1 （Q13098） COP9 signalosome complex subunit 3 × 1 （Q9UNS2） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NEDD8_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain I； PDBConstruct 1–81； UniProt 1–81

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9eg1
Deposition date deposition_date	2024-11-20
Structure title title	COP9 signalosome deneddylation complex with cullin-5
Keywords keywords	COP9, COP9 signalosome, signalosome, NEDD8, N8CUL5, deneddylation, CSN5, CUL5, metalloprotease, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9eg1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9eg1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9eg1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.09 Å
Rg (electron density)	54.85 Å
Total Rg	54.80 Å
Atom count	23752
Residues	3071
Excluded volume	423000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9eg1__assembly_1__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	COP9 signalosome complex subunit 2
Molecular weight formula_weight	51664.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	23752

MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	COP9 signalosome complex subunit 4
Molecular weight formula_weight	46322.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAAAVRQDLAQLMNSSGSHKDLAGKYRQILEKAIQLSGAEQLEALKAFVEAMVNENVSLVISRQLLTDFCTHLPNLPDSTAKEIYHFTLEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	COP9 signalosome complex subunit 5
Molecular weight formula_weight	37562.7 kDa
EC 编号 ec_number	3.4.-.-
Mutation mutation	E76A, D151N
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLAVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGINVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	COP9 signalosome complex subunit 6
Molecular weight formula_weight	36203.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MAAAAAAAAATNGTGGSSGMEVDAAVVPSVMACGVTGSVSVALHPLVILNISDHWIRMRSQEGRPVQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	COP9 signalosome complex subunit 7b
Molecular weight formula_weight	29656.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAGEQKPSSNLLEQFILLAKGTSGSALTALISQVLEAPGVYVFGELLELANVQELAEGANAAYLQLLNLFAYGTYPDYIANKESLPELSTAQQNKLKHLTIVSLASRMKCIPYSVLLKDLEMRNLRELEDLIIEAVYTDIIQGKLDQRNQLLEVDFCIGRDIRKKDINNIVKTLHEWCDGCEAVLLGIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLVSSRH

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	COP9 signalosome complex subunit 8
Molecular weight formula_weight	23245.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 7 Entity 7 polymer

Description description	Cullin-5
Molecular weight formula_weight	91085.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 8 Entity 8 polymer

Description description	RING-box protein 2
Molecular weight formula_weight	12697.4 kDa
EC 编号 ec_number	2.3.2.27,2.3.2.32
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 9 Entity 9 polymer

Description description	COP9 signalosome complex subunit 1
Molecular weight formula_weight	55606.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MPLPVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASYSGLMRIERLQFIADHCPTLRVEALKMALSFVQRTFNVDMYEEIHRKLSEATRSSLRELQNAPDAIPESGVEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSYVSKAESTPEIAEQRGERDSQTQAILTKLKCAAGLAELAARKYKQAAKCLLLASFDHCDFPELLSPSNVAIYGGLCALATFDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMHRMAAAFNTTVAALEDELTQLILEGLISARVDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMMLRAAVLRNQIHVKSPPREGSQGELTPANSQSRMSTNM

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 10 Entity 10 polymer

Description description	COP9 signalosome complex subunit 3
Molecular weight formula_weight	47924.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MASALEQFVNSVRQLSAQGQMTQLCELINKSGELLAKNLSHLDTVLGALDVQEHSLGVLAVLFVKFSMPSVPDFETLFSQVQLFISTCNGEHIRYATDTFAGLCHQLTNALVERKQPLRGIGILKQAIDKMQMNTNQLTSIHADLCQLCLLAKCFKPALPYLDVDMMDICKENGAYDAKHFLCYYYYGGMIYTGLKNFERALYFYEQAITTPAMAVSHIMLESYKKYILVSLILLGKVQQLPKYTSQIVGRFIKPLSNAYHELAQVYSTNNPSELRNLVNKHSETFTRDNNMGLVKQCLSSLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 11 Entity 11 polymer

Description description	NEDD8
Molecular weight formula_weight	9086.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 12 Entity 12 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Resolution resolution	3.520 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.52 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	239911

COP9 signalosome deneddylation complex with cullin-5

1. Protein Identity and Related Structures Protein Identity & Related Structures

COP9 signalosome complex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COP9 signalosome complex subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COP9 signalosome complex subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COP9 signalosome complex subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COP9 signalosome complex subunit 7b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COP9 signalosome complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cullin-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RING-box protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COP9 signalosome complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COP9 signalosome complex subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer