9gjp

OCCM maturation intermediate stalled with an Arginine Finger mutation in Mcm5: Conformer 2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA replication licensing factor MCM2

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Cell division cycle protein CDT1 × 1 （P47112） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） DNA (42-MER) × 2 ADENOSINE-5'-DIPHOSPHATE × 4 ZINC ION × 5 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM2_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 2； PDBConstruct 1–868； UniProt 1–868

DNA replication licensing factor MCM3

Saccharomyces cerevisiae

UniProt P24279

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Cell division cycle protein CDT1 × 1 （P47112） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） DNA (42-MER) × 2 ADENOSINE-5'-DIPHOSPHATE × 4 ZINC ION × 5 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM3_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 3； PDBConstruct 36–1006； UniProt 1–971

DNA replication licensing factor MCM4

Saccharomyces cerevisiae

UniProt P30665

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Cell division cycle protein CDT1 × 1 （P47112） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） DNA (42-MER) × 2 ADENOSINE-5'-DIPHOSPHATE × 4 ZINC ION × 5 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM4_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 4； PDBConstruct 1–933； UniProt 1–933

Minichromosome maintenance protein 5

Saccharomyces cerevisiae

UniProt P29496

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Cell division cycle protein CDT1 × 1 （P47112） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） DNA (42-MER) × 2 ADENOSINE-5'-DIPHOSPHATE × 4 ZINC ION × 5 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM5_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 5； PDBConstruct 1–775； UniProt 1–775

DNA replication licensing factor MCM6

Saccharomyces cerevisiae

UniProt P53091

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM7 × 1 （P38132） Cell division cycle protein CDT1 × 1 （P47112） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） DNA (42-MER) × 2 ADENOSINE-5'-DIPHOSPHATE × 4 ZINC ION × 5 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM6_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 6； PDBConstruct 1–1017； UniProt 1–1017

DNA replication licensing factor MCM7

Saccharomyces cerevisiae

UniProt P38132

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） Cell division cycle protein CDT1 × 1 （P47112） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） DNA (42-MER) × 2 ADENOSINE-5'-DIPHOSPHATE × 4 ZINC ION × 5 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM7_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 7； PDBConstruct 1–845； UniProt 1–845

Cell division cycle protein CDT1

Saccharomyces cerevisiae

UniProt P47112

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） DNA (42-MER) × 2 ADENOSINE-5'-DIPHOSPHATE × 4 ZINC ION × 5 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDT1_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 8； PDBConstruct 1–604； UniProt 1–604

Origin recognition complex subunit 1

Saccharomyces cerevisiae

UniProt P54784

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Cell division cycle protein CDT1 × 1 （P47112） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） DNA (42-MER) × 2 ADENOSINE-5'-DIPHOSPHATE × 4 ZINC ION × 5 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ORC1_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain A； PDBConstruct 36–949； UniProt 1–914

Origin recognition complex subunit 2

Saccharomyces cerevisiae

UniProt P32833

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Cell division cycle protein CDT1 × 1 （P47112） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） DNA (42-MER) × 2 ADENOSINE-5'-DIPHOSPHATE × 4 ZINC ION × 5 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ORC2_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain B； PDBConstruct 1–620； UniProt 1–620

Origin recognition complex subunit 3

Saccharomyces cerevisiae

UniProt P54790

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Cell division cycle protein CDT1 × 1 （P47112） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） DNA (42-MER) × 2 ADENOSINE-5'-DIPHOSPHATE × 4 ZINC ION × 5 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ORC3_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain C； PDBConstruct 1–616； UniProt 1–616

Origin recognition complex subunit 4

Saccharomyces cerevisiae

UniProt P54791

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Cell division cycle protein CDT1 × 1 （P47112） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 5 × 1 （P50874） Origin recognition complex subunit 6 × 1 （P38826） DNA (42-MER) × 2 ADENOSINE-5'-DIPHOSPHATE × 4 ZINC ION × 5 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ORC4_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain D； PDBConstruct 1–529； UniProt 1–529

Origin recognition complex subunit 5

Saccharomyces cerevisiae

UniProt P50874

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Cell division cycle protein CDT1 × 1 （P47112） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 6 × 1 （P38826） DNA (42-MER) × 2 ADENOSINE-5'-DIPHOSPHATE × 4 ZINC ION × 5 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ORC5_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain E； PDBConstruct 1–479； UniProt 1–479

Origin recognition complex subunit 6

Saccharomyces cerevisiae

UniProt P38826

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Cell division cycle protein CDT1 × 1 （P47112） Origin recognition complex subunit 1 × 1 （P54784） Origin recognition complex subunit 2 × 1 （P32833） Origin recognition complex subunit 3 × 1 （P54790） Origin recognition complex subunit 4 × 1 （P54791） Origin recognition complex subunit 5 × 1 （P50874） DNA (42-MER) × 2 ADENOSINE-5'-DIPHOSPHATE × 4 ZINC ION × 5 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ORC6_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain F； PDBConstruct 1–435； UniProt 1–435

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9gjp
Deposition date deposition_date	2024-08-22
Structure title title	OCCM maturation intermediate stalled with an Arginine Finger mutation in Mcm5: Conformer 2
Keywords keywords	AAA+ ATPase, DNA translocase, ATPase switch, DNA replication, REPLICATION; REPLICATION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9gjp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9gjp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9gjp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	62.97 Å
Rg (electron density)	63.06 Å
Total Rg	63.03 Å
Atom count	50292
Residues	6120
Excluded volume	894590 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9gjp__assembly_1__model_1`	15-meric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	DNA replication licensing factor MCM2
Molecular weight formula_weight	98911.5 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2
Atom count atom_count	50292

MSDNRRRRREEDDSDSENELPPSSPQQHFRGGMNPVSSPIGSPDMINPEGDDNEVDDVPDIDEVEEQMNEVDLMDDNMYEDYAADHNRDRYDPDQVDDREQQELSLSERRRIDAQLNERDRLLRNVAYIDDEDEEQEGAAQLDEMGLPVQRRRRRRQYEDLENSDDDLLSDMDIDPLREELTLESLSNVKANSYSEWITQPNVSRTIARELKSFLLEYTDETGRSVYGARIRTLGEMNSESLEVNYRHLAESKAILALFLAKCPEEMLKIFDLVAMEATELHYPDYARIHSEIHVRISDFPTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIRISFCTNCKSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIYKNNYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDMDKVSRVYADLRRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKVVVDSFVDAQKVSVRRQLRRSFAIYTLGH

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 2 Entity 2 polymer

Description description	DNA replication licensing factor MCM3
Molecular weight formula_weight	111720.2 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MKRRWKKNFIAVSAANRFKKISSSGALENLYFQGEMEGSTGFDGDATTFFAPDAVFGDRVRRFQEFLDTFTSYRDSVRSIQVYNSNNAANYNDDQDDADERDLLGDDDGDDLEKEKKAASSTSLNILPHRIIISLDDLREFDRSFWSGILVEPAYFIPPAEKALTDLADSMDDVPHPNASAVSSRHPWKLSFKGSFGAHALSPRTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTPAIYPTEDTEGNKLTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKPGDRVNVVGVFKSLGAGGMNQSNSNTLIGFKTLILGNTVYPLHARSTGVAARQMLTDFDIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPPGYLEGEPVRERLNLSLAVGEDADINPEEHSNSGAGVENEGEDDEDHVFEKFNPLLQAGAKLAKNKGNYNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQEAINVIVKNYTDLRNDDNTKKSPITARTLETLIRLATAHAKVRLSKTVNKVDAKVAANLLRFALLGEDIGNDIDEEESEYEEALSKRSPQKSPKKRQRVRQPASNSGSPIKSTPRRSTASSVNATPSSARRILRFQDDEQNAGEDDNDIMSPLPADEEAELQRRLQLGLRVSPRRREHLHAPEEGSSGPLTEVGTPRLPNVSSAGQDDEQQQSVISFDNVEPGTISTGRLSLISGIIARLMQTEIFEEESYPVASLFERINEELPEEEKFSAQEYLAGLKIMSDRNNLMVADDKVWRV

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 3 Entity 3 polymer

Description description	DNA replication licensing factor MCM4
Molecular weight formula_weight	105138.4 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MSQQSSSPTKEDNNSSSPVVPNPDSVPPQLSSPALFYSSSSSQGDIYGRNNSQNLSQGEGNIRAAIGSSPLNFPSSSQRQNSDVFQSQGRQGRIRSSASASGRSRYHSDLRSDRALPTSSSSLGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDTSSSSAPPSEASEPLRIIWGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVESSDIQEALSRLQQEDKVIVLGEGVRRSVRLNNRV

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 4 Entity 4 polymer

Description description	Minichromosome maintenance protein 5
Molecular weight formula_weight	86419.6 kDa
EC 编号 ec_number	3.6.4.12
Mutation mutation	R549A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MSFDRPEIYSAPVLQGESPNDDDNTEIIKSFKNFILEFRLDSQFIYRDQLRNNILVKNYSLTVNMEHLIGYNEDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENTSMDTDSLLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNCRHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDPYIIIHESSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSIYNSKNGAGSGRSGGGNGGSGVAIRTPYIKILGIQSDVETSSIWNSVTMFTEEEEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNIDFQTTILSAFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSEISIEKMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEAIIRITESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLNQASGTSLSEIRRFEQELKRRLPIGWSTSYQTLRREFVDTHRFSQLALDKALYALEKHETIQLRHQGQNIYRSGV

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 5 Entity 5 polymer

Description description	DNA replication licensing factor MCM6
Molecular weight formula_weight	113110.2 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MSSPFPADTPSSNRPSNSSPPPSSIGAGFGSSSGLDSQIGSRLHFPSSSQPHVSNSQTGPFVNDSTQFSSQRLQTDGSATNDMEGNEPARSFKSRALNHVKKVDDVTGEKVREAFEQFLEDFSVQSTDTGEVEKVYRAQIEFMKIYDLNTIYIDYQHLSMRENGALAMAISEQYYRFLPFLQKGLRRVVRKYAPELLNTSDSLKRSEGDEGQADEDEQQDDDMNGSSLPRDSGSSAAPGNGTSAMATRSITTSTSPEQTERVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVRIQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSSTLDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRETELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMKRDEAIEPPFSAEQLRRYIKYARTFKPILTKEARSYLVEKYKELRKDDAQGFSRSSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDVDDVEMDEEFDNIESQSHAASGNNDDNDDGTGSGVITSEPPADIEEGQSEATARPGTSEKKKTTVTYDKYVSMMNMIVRKIAEVDREGAEELTAVDIVDWYLLQKENDLGSLAEYWEERRLAFKVIKRLVKDRILMEIHGTRHNLRDLENEENENNKTVYVIHPNCEVLDQLEPQDSS

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 6 Entity 6 polymer

Description description	DNA replication licensing factor MCM7
Molecular weight formula_weight	95049.9 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MSAALPSIQLPVDYNNLFNEITDFLVTFKQDTLSSDATRNENEDENLDAENIEQHLLEKGPKYMAMLQKVANRELNSVIIDLDDILQYQNEKFLQGTQADDLVSAIQQNANHFTELFCRAIDNNMPLPTKEIDYKDDVLDVILNQRRLRNERMLSDRTNEIRSENLMDTTMDPPSSMNDALREVVEDETELFPPNLTRRYFLYFKPLSQNCARRYRKKAISSKPLSVRQIKGDFLGQLITVRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTSEECSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPGDIVDVTGIFLPAPYTGFKALKAGLLTETYLEAQFVRQHKKKFASFSLTSDVEERVMELITSGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGVDKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLDNINLPAALLSRFDILFLMLDIPSRDDDEKLAEHVTYVHMHNKQPDLDFTPVEPSKMREYIAYAKTKRPVMSEAVNDYVVQAYIRLRQDSKREMDSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLVRVSKESLYQETNKSKEDESPTTKIFTIIKKMLQETGKNTLSYENIVKTVRLRGFTMLQLSNCIQEYSYLNVWHLINEGNTLKFVDDGTMDTDQEDSLVSTPKLAPQTTASANVSAQDSDIDLQDA

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 7 Entity 7 polymer

Description description	Cell division cycle protein CDT1
Molecular weight formula_weight	68486.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MSGTANSRRKEVLRVPVIDLNRVSDEEQLLPVVRAILLQHDTFLLKNYANKAVLDALLAGLTTKDLPDTSQGFDANFTGTLPLEDDVWLEQYIFDTDPQLRFDRKCRNESLCSIYSRLFKLGLFFAQLCVKSVVSSAELQDCISTSHYATKLTRYFNDNGSTHDGADAGATVLPTGDDFQYLFERDYVTFLPTGVLTIFPCAKAIRYKPSTMATTDNSWVSIDEPDCLLFHTGTLLARWSQGMHTTSPLQIDPRANIVSLTIWPPLTTPISSKGEGTIANHLLEQQIKAFPKVAQQYYPRELSILRLQDAMKFVKELFTVCETVLSLNALSRSTGVPPELHVLLPQISSMMKRKIVQDDILKLLTIWSDAYVVELNSRGELTMNLPKRDNLTTLTNKSRTLAFVERAESWYQQVIASKDEIMTDVPAFKINKRRSSSNSKTVLSSKVQTKSSNANALNNSRYLANSKENFMYKEKMPDSQANLMDRLRERERRSAALLSQRQKRYQQFLAMKMTQVFDILFSLTRGQPYTETYLSSLIVDSLQDSNNPIGTKEASEILAGLQGILPMDISVHQVDGGLKVYRWNSLDKNRFSKLLQIHKSKQQD

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 8 Entity 8 polymer

Description description	Origin recognition complex subunit 1
Molecular weight formula_weight	108612.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MKRRWKKNFIAVSAANRFKKISSSGALENLYFQGEMAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNEDGNEDESSDYESPSDIDVSEDMDSGEISADELEEEEDEEEDEDEEEKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLLISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFYGNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANFQDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMESLEFYFKRVPKNKKKTIVVLLDELDAMVTKSQDIMYNFFNWTTYENAKLIVIAVANTMDLPERQLGNKITSRIGFTRIMFTGYTHEELKNIIDLRLKGLNDSFFYVDTKTGNAILIDAAGNDTTVKQTLPEDVRKVRLRMSADAIEIASRKVASVSGDARRALKVCKRAAEIAEKHYMAKHGYGYDGKTVIEDENEEQIYDDEDKDLIESNKAKDDNDDDDDNDGVQTVHITHVMKALNETLNSHVITFMTRLSFTAKLFIYALLNLMKKNGSQEQELGDIVDEIKLLIEVNGSNKFVMEIAKTLFQQGSDNISEQLRIISWDFVLNQLLDAGILFKQTMKNDRICCVKLNISVEEAKRAMNEDETLRNL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 9 Entity 9 polymer

Description description	Origin recognition complex subunit 2
Molecular weight formula_weight	71342.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNTSPDPALKPKTPSKAPRKRGRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEESKTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSLTTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFLDTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLSANTGPKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEIIWVPYTYAELEKLLKTVLNTL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 10 Entity 10 polymer

Description description	Origin recognition complex subunit 3
Molecular weight formula_weight	72161.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSDLNQSKKMNVSEFADAQRSHYTVYPSLPQSNKNDKHIPFVKLLSGKESEVNVEKRWELYHQLHSHFHDQVDHIIDNIEADLKAEISDLLYSETTQKRRCFNTIFLLGSDSTTKIELKDESSRYNVLIELTPKESPNVRMMLRRSMYKLYSAADAEEHPTIKYEDINDEDGDFTEQNNDVSYDLSLVENFKRLFGKDLAMVFNFKDVDSINFNTLDNFIILLKSAFKYDHVKISLIFNINTNLSNIEKNLRQSTIRLLKRNYHKLDVSSNKGFKYGNQIFQSFLDTVDGKLNLSDRFVEFILSKMANNTNHNLQLLTKMLDYSLMSYFFQNAFSVFIDPVNVDFLNDDYLKILSRCPTFMFFVEGLIKQHAPADEILSLLTNKNRGLEEFFVEFLVRENPINGHAKFVARFLEEELNITNFNLIELYHNLLIGKLDSYLDRWSACKEYKDRLHFEPIDTIFQELFTLDNRSGLLTQSIFPSYKSNIEDNLLSWEQVLPSLDKENYDTLSGDLDKIMAPVLGQLFKLYREANMTINIYDFYIAFRETLPKEEILNFIRKDPSNTKLLELAETPDAFDKVALILFMQAIFAFENMGLIKFQSTKSYDLVEKCVWRGI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 11 Entity 11 polymer

Description description	Origin recognition complex subunit 4
Molecular weight formula_weight	60772.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MTISEARLSPQVNLLPIKRHSNEEVEETAAILKKRTIDNEKCKDSDPGFGSLQRRLLQQLYGTLPTDEKIIFTYLQDCQQEIDRIIKQSIIQKESHSVILVGPRQSYKTYLLDYELSLLQQSYKEQFITIRLNGFIHSEQTAINGIATQLEQQLQKIHGSEEKIDDTSLETISSGSLTEVFEKILLLLDSTTKTRNEDSGEVDRESITKITVVFIFDEIDTFAGPVRQTLLYNLFDMVEHSRVPVCIFGCTTKLNILEYLEKRVKSRFSQRVIYMPQIQNLDDMVDAVRNLLTVRSEISPWVSQWNETLEKELSDPRSNLNRHIRMNFETFRSLPTLKNSIIPLVATSKNFGSLCTAIKSCSFLDIYNKNQLSNNLTGRLQSLSDLELAILISAARVALRAKDGSFNFNLAYAEYEKMIKAINSRIPTVAPTTNVGTGQSTFSIDNTIKLWLKKDVKNVWENLVQLDFFTEKSAVGLRDNATAAFYASNYQFQGTMIPFDLRSYQMQIILQELRRIIPKSNMYYSWTQL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 12 Entity 12 polymer

Description description	Origin recognition complex subunit 5
Molecular weight formula_weight	55347.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MNVTTPEVAFREYQTNCLASYISADPDITPSNLILQGYSGTGKTYTLKKYFNANPNLHAVWLEPVELVSWKPLLQAIARTVQYKLKTLYPNIPTTDYDPLQVEEPFLLVKTLHNIFVQYESLQEKTCLFLILDGFDSLQDLDAALFNKYIKLNELLPKDSKINIKFIYTMLETSFLQRYSTHCIPTVMFPRYNVDEVSTILVMSRCGELMEDSCLRKRIIEEQITDCTDDQFQNVAANFIHLIVQAFHSYTGNDIFALNDLIDFKWPKYVSRITKENIFEPLALYKSAIKLFLSTDDNLSENGQGESAITTNRDDLENSQTYDLSIISKYLLIASYICSYLEPRYDASIFSRKTRIIQGRAAYGRRKKKEVNPRYLQPSLFAIERLLAIFQAIFPIQGKAESGSLSALREESLMKANIEVFQNLSELHTLKLIATTMNKNIDYLSPKVRWKVNVPWEIIKEISESVHFNISDYFSDIHE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 13 Entity 13 polymer

Description description	Origin recognition complex subunit 6
Molecular weight formula_weight	50369.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSMQQVQHCVAEVLRLDPQEKPDWSSGYLKKLTNATSILYNTSLNKVMLKQDEEVARCHICAYIASQKMNEKHMPDLCYYIDSIPLEPKKAKHLMNLFRQSLSNSSPMKQFAWTPSPKKNKRSPVKNGGRFTSSDPKELRNQLFGTPTKVRKSQNNDSFVIPELPPMQTNESPSITRRKLAFEEDEDEDEEEPGNDGLSLKSHSNKSITGTRNVDSDEYENHESDPTSEEEPLGVQESRSGRTKQNKAVGKPQSELKTAKALRKRGRIPNSLLVKKYCKMTTEEIIRLCNDFELPREVAYKIVDEYNINASRLVCPWQLVCGLVLNCTFIVFNERRRKDPRIDHFIVSKMCSLMLTSKVDDVIECVKLVKELIIGEKWFRDLQIRYDDFDGIRYDEIIFRKLGSMLQTTNILVTDDQYNIWKKRIEMDLALTEPL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 14 Entity 14 polymer

Description description	DNA (42-MER)
Molecular weight formula_weight	12931.3 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	X,Y

CGATCGATCGATCGATCGATCGATCGATCGATCGATCGATCG

Entity 15 Entity 15 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 16 Entity 16 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 17 Entity 17 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	151030

OCCM maturation intermediate stalled with an Arginine Finger mutation in Mcm5: Conformer 2

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA replication licensing factor MCM2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Minichromosome maintenance protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division cycle protein CDT1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Origin recognition complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Origin recognition complex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Origin recognition complex subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer