9hpa

Structure of A16/G9 (vaccinia virus) in complex with VHH D07 and VHH E12

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Virion membrane protein OPG143

Vaccinia virus Western Reserve

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Entry-fusion complex protein OPG094 × 1 （P07611） VHH E12 × 1 VHH D07 × 1 PHOSPHATE ION × 1 SULFATE ION × 3 DI(HYDROXYETHYL)ETHER × 2 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Entry-fusion complex protein OPG094 × 1 （P07611） VHH E12 × 1 VHH D07 × 1 PHOSPHATE ION × 1 SULFATE ION × 1 DI(HYDROXYETHYL)ETHER × 3 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PG143_VACCW
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 22–314； UniProt 3–295 Author chain E； PDBConstruct 22–314； UniProt 3–295

Entry-fusion complex protein OPG094

Vaccinia virus Western Reserve

UniProt P07611

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Virion membrane protein OPG143 × 1 （P16710） VHH E12 × 1 VHH D07 × 1 PHOSPHATE ION × 1 SULFATE ION × 3 DI(HYDROXYETHYL)ETHER × 2 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Virion membrane protein OPG143 × 1 （P16710） VHH E12 × 1 VHH D07 × 1 PHOSPHATE ION × 1 SULFATE ION × 1 DI(HYDROXYETHYL)ETHER × 3 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PG094_VACCW
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 20–288； UniProt 3–271 Author chain F； PDBConstruct 20–288； UniProt 3–271

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9hpa
Deposition date deposition_date	2024-12-12
Structure title title	Structure of A16/G9 (vaccinia virus) in complex with VHH D07 and VHH E12
Keywords keywords	poxvirus, viral fusion, vaccinia virus, mpox virus, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9hpa__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9hpa__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9hpa__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	39.18 Å
Rg (electron density)	40.78 Å
Total Rg	40.64 Å
Atom count	6346
Residues	790
Excluded volume	111570 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9hpa__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9hpa__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Virion membrane protein OPG143
Molecular weight formula_weight	40941.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E
Atom count atom_count	12788

MKLCILLAVVAFVGLSLGRSAAAVTLNRIKIAPGIADIRDKYMELGFNYPEYNRAVKFAEESYTYYYETSPGEIKPKFCLIDGMSIDHCSSFIVPEFAKQYVLIHGEPCSSFKFRPGSLIYYQNEVTPEYIKDLKHATDYIASGQRCHFIKKDYLLGDSDSVAKCCSKTNTKHCPKIFNNNYKTEHCDDFMTGFCRNDPGNPNCLEWLRAKRKPAMSTYSDICSKHMDARYCSEFIRIIRPDYFTFGDTALYVFCNDHKGNRNCWCANYPKSNSGDKYLGPRVCWLHECTDESRDRKWLYYNQDVQRTRCKYVGGSGLVPRGSGGSGGSHHHHHHHHGGSGTGGLNDIFEAQKIEWHE

Source Source

Source organism organism	Vaccinia virus Western Reserve
NCBI taxonomy ID ncbi_taxonomy_id	696871
Host organism host_organism	Drosophila melanogaster

Entity 2 Entity 2 polymer

Description description	Entry-fusion complex protein OPG094
Molecular weight formula_weight	37432.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F

MKLCILLAVVAFVGLSLGAGGVSVELPKRDPPPGVPTDEMLLNVDKMHDVIAPAKLLEYVHIGPLAKDKEDKVKKRYPEFRLVNTGPGGLSALLRQSYAGTAPNCCRTFQRTHYWKKDGKISDKYEEGAVLESCWPDVHDTGKCDVDLFDWCQGDTFDRNICHQWIGSAFNRADRTVEGQQSLINLYNKMQTLCSKDASVPICESFLHHLRAHNTEDSKEMIDYILRQQSADFKQKYMRCSYPTRDKLEESLKYAEPRECWDPECSNANVNFLLTRNYNNLGLCNIVRGSGLVPRGSLEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEK

Source Source

Source organism organism	Vaccinia virus Western Reserve
NCBI taxonomy ID ncbi_taxonomy_id	696871
Host organism host_organism	Drosophila melanogaster

Entity 3 Entity 3 polymer

Description description	VHH E12
Molecular weight formula_weight	17105.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H

MGEVQLVESGGGLVQAGGSLRLSCVASGSIFMIDDMGWYRRAPGNEREWVATTHSGGSTVYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNAQGLTGSRQRYDVLGQGTQVTVSSLEHHHHHHHHGSGLVPRGSGLNDIFEAQKIEWHE

Source Source

Source organism organism	Vicugna pacos
NCBI taxonomy ID ncbi_taxonomy_id	30538
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	VHH D07
Molecular weight formula_weight	16965.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G

MGEVQLQASGGGLVQPGGSLRLSCAASGIVFSNNRMSWYRQAPGKQREVVATITSGGATDYQDSVEGRFTISRDMAKNTVYLQMNSLKPEDTAVYFCNARRDNFATAIYWGQGTQVTVSSLEHHHHHHHHGSGLVPRGSGLNDIFEAQKIEWHE

Source Source

Source organism organism	Vicugna pacos
NCBI taxonomy ID ncbi_taxonomy_id	30538
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 7 Entity 7 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	99

▶

Unit-cell length a length_a	78.204 Å
Unit-cell length b length_b	148.041 Å
Unit-cell length c length_c	185.708 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	orthorhombic

Resolution resolution	3.100 Å
Low-resolution limit resolution_low	39.330 Å
R factor r_factor	0.2248
R_work r_work	0.2225
R_free r_free	0.2652

Structure of A16/G9 (vaccinia virus) in complex with VHH D07 and VHH E12

1. Protein Identity and Related Structures Protein Identity & Related Structures

Virion membrane protein OPG143

State in the Current Structure

Other States of the Same Protein in the Database

Entry-fusion complex protein OPG094

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9hpa__assembly_1__model_1

9hpa__assembly_1__model_1 | I(q)

9hpa__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (1)

Structure of A16/G9 (vaccinia virus) in complex with VHH D07 and VHH E12

1. Protein Identity and Related Structures Protein Identity & Related Structures

Virion membrane protein OPG143

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Entry-fusion complex protein OPG094

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9hpa__assembly_1__model_1

9hpa__assembly_1__model_1 | I(q)

9hpa__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (1)