9ki1

Baseplate structure of Escherichia phage Mu

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA circularization protein N

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	Tail sheath protein × 6 （P79678） Tail tube protein × 6 （P79679） Baseplate protein gp46 × 6 （Q9T1V3） Baseplate hub protein gp44 × 3 （P08558） Baseplate protein gp47 × 12 （Q9T1V2） Baseplate puncturing device gp45 × 3 （Q9T1V4） Baseplate protein gp48 × 6 （Q9T1V1） Probable tape measure protein × 3 （Q9T1V6） Tail fiber protein S × 9 （Q9T1V0） CALCIUM ION × 1 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CIRCN_BPMU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–495； UniProt 1–495 Author chain s； PDBConstruct 1–495； UniProt 1–495 Author chain t； PDBConstruct 1–495； UniProt 1–495 Author chain u； PDBConstruct 1–495； UniProt 1–495 Author chain v； PDBConstruct 1–495； UniProt 1–495 Author chain w； PDBConstruct 1–495； UniProt 1–495

Tail sheath protein

OrganismNot specified

UniProt P79678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	DNA circularization protein N × 6 （P08557） Tail tube protein × 6 （P79679） Baseplate protein gp46 × 6 （Q9T1V3） Baseplate hub protein gp44 × 3 （P08558） Baseplate protein gp47 × 12 （Q9T1V2） Baseplate puncturing device gp45 × 3 （Q9T1V4） Baseplate protein gp48 × 6 （Q9T1V1） Probable tape measure protein × 3 （Q9T1V6） Tail fiber protein S × 9 （Q9T1V0） CALCIUM ION × 1 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TSP_BPMU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–495； UniProt 1–495 Author chain 2； PDBConstruct 1–495； UniProt 1–495 Author chain 3； PDBConstruct 1–495； UniProt 1–495 Author chain x； PDBConstruct 1–495； UniProt 1–495 Author chain y； PDBConstruct 1–495； UniProt 1–495 Author chain z； PDBConstruct 1–495； UniProt 1–495

Tail tube protein

OrganismNot specified

UniProt P79679

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	DNA circularization protein N × 6 （P08557） Tail sheath protein × 6 （P79678） Baseplate protein gp46 × 6 （Q9T1V3） Baseplate hub protein gp44 × 3 （P08558） Baseplate protein gp47 × 12 （Q9T1V2） Baseplate puncturing device gp45 × 3 （Q9T1V4） Baseplate protein gp48 × 6 （Q9T1V1） Probable tape measure protein × 3 （Q9T1V6） Tail fiber protein S × 9 （Q9T1V0） CALCIUM ION × 1 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TUBE_BPMU
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 4； PDBConstruct 1–118； UniProt 1–118 Author chain 5； PDBConstruct 1–118； UniProt 1–118 Author chain 6； PDBConstruct 1–118； UniProt 1–118 Author chain 7； PDBConstruct 1–118； UniProt 1–118 Author chain 8； PDBConstruct 1–118； UniProt 1–118 Author chain 9； PDBConstruct 1–118； UniProt 1–118

Baseplate protein gp46

OrganismNot specified

UniProt Q9T1V3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	DNA circularization protein N × 6 （P08557） Tail sheath protein × 6 （P79678） Tail tube protein × 6 （P79679） Baseplate hub protein gp44 × 3 （P08558） Baseplate protein gp47 × 12 （Q9T1V2） Baseplate puncturing device gp45 × 3 （Q9T1V4） Baseplate protein gp48 × 6 （Q9T1V1） Probable tape measure protein × 3 （Q9T1V6） Tail fiber protein S × 9 （Q9T1V0） CALCIUM ION × 1 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP46_BPMU
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 1–145； UniProt 1–145 Author chain B； PDBConstruct 1–145； UniProt 1–145 Author chain C； PDBConstruct 1–145； UniProt 1–145 Author chain D； PDBConstruct 1–145； UniProt 1–145 Author chain E； PDBConstruct 1–145； UniProt 1–145 Author chain F； PDBConstruct 1–145； UniProt 1–145

Baseplate hub protein gp44

OrganismNot specified

UniProt P08558

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	DNA circularization protein N × 6 （P08557） Tail sheath protein × 6 （P79678） Tail tube protein × 6 （P79679） Baseplate protein gp46 × 6 （Q9T1V3） Baseplate protein gp47 × 12 （Q9T1V2） Baseplate puncturing device gp45 × 3 （Q9T1V4） Baseplate protein gp48 × 6 （Q9T1V1） Probable tape measure protein × 3 （Q9T1V6） Tail fiber protein S × 9 （Q9T1V0） CALCIUM ION × 1 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP44_BPMU
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–379； UniProt 1–379 Author chain N； PDBConstruct 1–379； UniProt 1–379 Author chain U； PDBConstruct 1–379； UniProt 1–379

Baseplate protein gp47

OrganismNot specified

UniProt Q9T1V2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	DNA circularization protein N × 6 （P08557） Tail sheath protein × 6 （P79678） Tail tube protein × 6 （P79679） Baseplate protein gp46 × 6 （Q9T1V3） Baseplate hub protein gp44 × 3 （P08558） Baseplate puncturing device gp45 × 3 （Q9T1V4） Baseplate protein gp48 × 6 （Q9T1V1） Probable tape measure protein × 3 （Q9T1V6） Tail fiber protein S × 9 （Q9T1V0） CALCIUM ION × 1 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP47_BPMU
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H； PDBConstruct 1–360； UniProt 1–360 Author chain I； PDBConstruct 1–360； UniProt 1–360 Author chain J； PDBConstruct 1–360； UniProt 1–360 Author chain K； PDBConstruct 1–360； UniProt 1–360 Author chain L； PDBConstruct 1–360； UniProt 1–360 Author chain M； PDBConstruct 1–360； UniProt 1–360 Author chain O； PDBConstruct 1–360； UniProt 1–360 Author chain P； PDBConstruct 1–360； UniProt 1–360 Author chain Q； PDBConstruct 1–360； UniProt 1–360 Author chain R； PDBConstruct 1–360； UniProt 1–360 Author chain S； PDBConstruct 1–360； UniProt 1–360 Author chain T； PDBConstruct 1–360； UniProt 1–360

Baseplate puncturing device gp45

OrganismNot specified

UniProt Q9T1V4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	DNA circularization protein N × 6 （P08557） Tail sheath protein × 6 （P79678） Tail tube protein × 6 （P79679） Baseplate protein gp46 × 6 （Q9T1V3） Baseplate hub protein gp44 × 3 （P08558） Baseplate protein gp47 × 12 （Q9T1V2） Baseplate protein gp48 × 6 （Q9T1V1） Probable tape measure protein × 3 （Q9T1V6） Tail fiber protein S × 9 （Q9T1V0） CALCIUM ION × 1 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP45_BPMU
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain V； PDBConstruct 1–197； UniProt 1–197 Author chain W； PDBConstruct 1–197； UniProt 1–197 Author chain X； PDBConstruct 1–197； UniProt 1–197

Baseplate protein gp48

OrganismNot specified

UniProt Q9T1V1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	DNA circularization protein N × 6 （P08557） Tail sheath protein × 6 （P79678） Tail tube protein × 6 （P79679） Baseplate protein gp46 × 6 （Q9T1V3） Baseplate hub protein gp44 × 3 （P08558） Baseplate protein gp47 × 12 （Q9T1V2） Baseplate puncturing device gp45 × 3 （Q9T1V4） Probable tape measure protein × 3 （Q9T1V6） Tail fiber protein S × 9 （Q9T1V0） CALCIUM ION × 1 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP48_BPMU
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain a； PDBConstruct 1–180； UniProt 1–180 Author chain b； PDBConstruct 1–180； UniProt 1–180 Author chain c； PDBConstruct 1–180； UniProt 1–180 Author chain d； PDBConstruct 1–180； UniProt 1–180 Author chain e； PDBConstruct 1–180； UniProt 1–180 Author chain f； PDBConstruct 1–180； UniProt 1–180

Probable tape measure protein

OrganismNot specified

UniProt Q9T1V6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	DNA circularization protein N × 6 （P08557） Tail sheath protein × 6 （P79678） Tail tube protein × 6 （P79679） Baseplate protein gp46 × 6 （Q9T1V3） Baseplate hub protein gp44 × 3 （P08558） Baseplate protein gp47 × 12 （Q9T1V2） Baseplate puncturing device gp45 × 3 （Q9T1V4） Baseplate protein gp48 × 6 （Q9T1V1） Tail fiber protein S × 9 （Q9T1V0） CALCIUM ION × 1 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TMP_BPMU
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain g； PDBConstruct 1–690； UniProt 1–690 Author chain h； PDBConstruct 1–690； UniProt 1–690 Author chain i； PDBConstruct 1–690； UniProt 1–690

Tail fiber protein S

OrganismNot specified

UniProt Q9T1V0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	DNA circularization protein N × 6 （P08557） Tail sheath protein × 6 （P79678） Tail tube protein × 6 （P79679） Baseplate protein gp46 × 6 （Q9T1V3） Baseplate hub protein gp44 × 3 （P08558） Baseplate protein gp47 × 12 （Q9T1V2） Baseplate puncturing device gp45 × 3 （Q9T1V4） Baseplate protein gp48 × 6 （Q9T1V1） Probable tape measure protein × 3 （Q9T1V6） CALCIUM ION × 1 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S1_BPMU
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain j； PDBConstruct 1–504； UniProt 1–504 Author chain k； PDBConstruct 1–504； UniProt 1–504 Author chain l； PDBConstruct 1–504； UniProt 1–504 Author chain m； PDBConstruct 1–504； UniProt 1–504 Author chain n； PDBConstruct 1–504； UniProt 1–504 Author chain o； PDBConstruct 1–504； UniProt 1–504 Author chain p； PDBConstruct 1–504； UniProt 1–504 Author chain q； PDBConstruct 1–504； UniProt 1–504 Author chain r； PDBConstruct 1–504； UniProt 1–504

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ki1
Deposition date deposition_date	2024-11-11
Structure title title	Baseplate structure of Escherichia phage Mu
Keywords keywords	phage, sheath, tube, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ki1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ki1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ki1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	79.71 Å
Rg (electron density)	79.28 Å
Total Rg	79.35 Å
Atom count	114473
Residues	15018
Excluded volume	2025800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ki1__assembly_1__model_1`	60-meric （60）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	DNA circularization protein N
Molecular weight formula_weight	52086.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,s,t,u,v,w
Atom count atom_count	114473

MFEDALNAVNAVRDKTGGGRKTTGKGTFRNVPFLVIEEQKQAGGRRLVKREYPLRDTGGVNDLGKKLRSRTFSACILNSNAETARDEAGALMDALDAPGSGELVHPDFGTVDVMVDSWECRTKADELNYYAFTVTVYPSLQDTAPDAETDTSAAVPAQAVAVTGSLGDTLSSVWQTVKDGTAAATAVMEAVTGVIDDISDAVDNLGVTQTVSGLMGSLSAMKGSVTSLINQPAMLASSLMGALSGVSSLCDTRTAFSTWNRLAQRFERRHAATAGRQGTITTSYNSPVAEKNIATLNYVMLAAAQTYRAEAASQALTAALDFSRRMDNAARAPVLDAPSTTTGTASGASSTSATVTQGQLQLTAITPDGGFSQVSFSDSGTATPPVFESVSDIEKTTAMLGAALDSVILTASEQGFSTDSVQLTQLRLLVVADLEKRGLQLAGSESHHLPETLPAMVALYRFTGNSRNWQRLARRNGISNPLFVPGGVSIEVINE

Entity 2 Entity 2 polymer

Description description	Tail sheath protein
Molecular weight formula_weight	53132.5 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2,3,x,y,z

MSDISFNAIPSDVRVPLTYIEFDNSNAVSGTPAPRQRVLMFGQSGSKASAAPNVPVRIRSGSQASAAFGQGSMLALMADAFLNANRVAELWCIPQGNGTGNAAVGEISLSGTAGENGSLVTYIAGQRLAVSVAAGATGAALADLLVARIKGQPDLPVTAEVRADSGDDDTHADVVLSAKFTGALSAVDVRWNYYAGETTPYGIITAFKAASGKNGNPDISASIAGMGDLQYKYIVMPYTDEPNLNLLRTELQERWGPVNQADGFAVTVLSGTYGDISTFGVSRNDHLISCMGIAGAPEPSYLYAATLCAVASQALSIDPARPLQTLTLPGRMPPAVGDRFTWSERNALLFDGISTFNVNDGGEMQIERMITMYRTNKYGDSDPSYLNVNTIATLSYLRYSLRTRITQKFPNYKLASDGTRFATGQAVVTPSVIKTELLALFEEWENAGLVEDFDTFKEELYVARNKDDKDRLDVLCGPNLINQFRIFAAQVQFIL

Entity 3 Entity 3 polymer

Description description	Tail tube protein
Molecular weight formula_weight	12840.5 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,5,6,7,8,9

MAGNQRQGVAFIRVNGMELESMEGASFTPSGITREEVTGSRVYGWKGKPRAAKVECKIPGGGPIGLDEIIDWENITVEFQADTGETWMLANAWQADEPKNDGGEISLVLMAKQSKRIA

Entity 4 Entity 4 polymer

Description description	Baseplate protein gp46
Molecular weight formula_weight	16340.2 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F

MTDLAIIWTNGRGDIAQDGIDMLTDDSLTTDVTISLFTDRRALDSDTLPDGSDDRRGWWGDSYRDRPIGSRLWLLSREKATPDTLERARGYAEEALEWLKTAGRVSAINVRAEQLHQGWLYLYIALTLPDGSVIPYEFKAAFNGV

Entity 5 Entity 5 polymer

Description description	Baseplate hub protein gp44
Molecular weight formula_weight	41840.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,N,U

MSNTVTLRADGRLFTGWTSVSVTRSIESVAGYFELGVNVPPGTDLSGLAPGKKFTLEIGGQIVCTGYIDSRRRQMTADSMKITVAGRDKTADLIDCAAVYSGGQWKNRTLEQIARDLCAPYGVTVRWELSDKESSAAFPGFTLDHSETVYEALVRASRARGVLMTSNAAGELVFSRAASTATDELVLGENLLTLDFEEDFRDRFSEYTVKGYARANGAEGDDIDAKSIVSRKGTATDSDVTRYRPMIIIADSKITAKDAQARALREQRRRLAKSITFEAEIDGWTRKDGQLWMPNLLVTIDASKYAIKTTELLVSKVTLILNDQDGLKTRVSLAPREGFLVPVESDRKNRKGGDSNGGIDALVEDYYRRHPEKTPPWKE

Entity 6 Entity 6 polymer

Description description	Baseplate protein gp47
Molecular weight formula_weight	38724.6 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,I,J,K,L,M,O,P,Q,R,S,T

MAYSPPTLSSLIARTEQNIEQRLPGSWPQAREKTLSAIAYAQAGLAAGCHEHISWVGRQIIPSTADEDELLEHCRFWGVRRKQATAASGPLTVTTSAATTIPAGTRWQRADGVVYSLADTIVIDRAGTTEITVTALAAGEAGNTGENTLLTLITPVACVVSDAITVKGFSGGADIESAAELLSRLEYRVQYPPFGGNQFDYVRWAREVSGVTRAWCFPTWKGGGTVGVTFVMDNRSNIFPQPADVERVADYIAGHTDPITGLIVGQPDGVNVTVFAPKAKPVNPRIYISPKTAELKQAITNAINTMFFNEVMPGGALAPSRIIRAVAGVTGLDDFEVRFPTEIQRSENTELLTAGTIEWL

Entity 7 Entity 7 polymer

Description description	Baseplate puncturing device gp45
Molecular weight formula_weight	21720.5 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,W,X

MERVNDSALNRLLTPLMRRVRLMLARAVVNVINDGRKVQNLQVGLLDDEESDEVERLQNYGHFSVPLPGAEALIACVGAQRDQGIAVVVEDRRYRPTNLEPGDAGIYHHEGHRIRLTKDGRCIITCKTVEVYADESMTVDTPRTTFTGDVEIQKGLGVKGKSQFDSNITAPDAIINGKSTDKHIHRGDSGGTTGPMQ

Entity 8 Entity 8 polymer

Description description	Baseplate protein gp48
Molecular weight formula_weight	20489.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f

MAVTPWQTAFLQLLPSGLAWNKSPDSKLSALAQAISDVIATAADDARQMLRERFPSTSRWYLGEWESFLGLPDCTSENGTLSERQRAAANKMRMTGNLSRRFYEWLAAQYGFTVRLTDSTEGQWVTQVNIYGIKNYRNATVLDNVLTPLRVYESGALECLLEKYKPAHQIYKFVYHDGDN

Entity 9 Entity 9 polymer

Description description	Probable tape measure protein
Molecular weight formula_weight	73682.8 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h,i

MTGKRLKASVIIDLNGNLSRRSRQYSNQINALSRSGQSSLRALRMEVVRVSGAIDRMGSLSTRTFRMLSAGALGIAGVGYTANKLFIGAAAQREQQIIAMNSLYHGDKVRAQAMMAWAKQNAKDTTWGLSGVLDEIRSSKGFGMTDEQTKQFITMLQDQGAMHGWDLPTAQGASLQLKQMFARQQITAADANLLTGYGINVYQALADATGTDVKKIRDLGTKGKLGMKSILTVFRTLSEQSKGAQASAMNSWDGMFAQMEANLLEFRIKVANSGPFEEIKNEMRRVLNWHDMADKSGELDALAENIGQKFLTTFRTVKISAQELWRWLKPGKDALAWVDQNIVSLKKLAAVLVSVWLANKALRAGWAVAKPSWQVASYPFKTGRRMWRWMRNRKRGQAGLPVPDAMTSETLLQGIGIQRVFVINWPRGFGDYGSGGGRRVRSGGRMAPLLPRQPLLLSGPQPLALPAPRPVLALPPPGVPVTARPAPLPLPGKSGLLSRLAGSAAGQLVTGTVGKLADAGRAVGGWFSGIGNKLAGSAIGRVVTKGAGALGWMGKGAGRALSRLGGPVMGALQLAPVLMDEQASTHEKAGAIGSTAGAWLGGAVGSLAGPLGTVAGATLGSVAGEYLGGFVTDLYQKWTATDKEPQEQKVNAEASLRVELGEGLRLTSSRVTEDGMGLNIYAGDNYITGW

Entity 10 Entity 10 polymer

Description description	Tail fiber protein S
Molecular weight formula_weight	55412.6 kDa
Source method src_method	nat
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j,k,l,m,n,o,p,q,r

MFYIDNDSGVTVMPPVSAQRSAIVRWFSEGDGNNVITWPGMDWFNIVQAELLNTLEEAGIQPDKTKLNQLALSIKAIMSNNALLIKNNLSEIKTAGASAQRTARENLDIYDASLNKKGLVQLTSATDSPSETLAATAKAVKIAMDNANARLAKDRNGADIPNKPLFIQNLGLQETVNRARNAVQKNGDTLSGGLTFENDSILAWIRNTDWAKIGFKNDADSDTDSYMWFETGDNGNEYFKWRSKQSTTTKDLMNLKWDALSVLVNAIVNGEVISKSANGLRIAYGNYGFFIRNDGSNTYFMLTNSGDNMGTYNGLRPLWINNATGAVSMGRGLNVSGDTLSDRFAINSSNGMWIQMRDNNAIFGKNIVNTDSAQALLRQNHADRKFMIGGLGNKQFGIYMINNSRTANGTDGQAYMDNNGNWLCGAQVIPGNYANFDSRYVRDVRLGTQSLTGGLSRDYKAPSGHVITGFHTNGDWEMQGGDDKVYIRPVQKNINGTWYNVASA

Entity 11 Entity 11 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 12 Entity 12 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Resolution resolution	3.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	46000

Baseplate structure of Escherichia phage Mu

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA circularization protein N

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tube protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate protein gp46

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate hub protein gp44

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate protein gp47

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate puncturing device gp45

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate protein gp48

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Probable tape measure protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail fiber protein S

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer