9mog

Structure of the distal part of the bacteriophage T4 tail

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

gp12, short tail fiber protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FIB12_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain S0； PDBConstruct 1–527； UniProt 1–527 Author chain S1； PDBConstruct 1–527； UniProt 1–527 Author chain S2； PDBConstruct 1–527； UniProt 1–527 Author chain S3； PDBConstruct 1–527； UniProt 1–527 Author chain S4； PDBConstruct 1–527； UniProt 1–527 Author chain S5； PDBConstruct 1–527； UniProt 1–527 Author chain S6； PDBConstruct 1–527； UniProt 1–527 Author chain S7； PDBConstruct 1–527； UniProt 1–527 Author chain S8； PDBConstruct 1–527； UniProt 1–527 Author chain SA； PDBConstruct 1–527； UniProt 1–527 Author chain SO； PDBConstruct 1–527； UniProt 1–527 Author chain SP； PDBConstruct 1–527； UniProt 1–527 Author chain SQ； PDBConstruct 1–527； UniProt 1–527 Author chain Sv； PDBConstruct 1–527； UniProt 1–527 Author chain Sw； PDBConstruct 1–527； UniProt 1–527 Author chain Sx； PDBConstruct 1–527； UniProt 1–527 Author chain Sy； PDBConstruct 1–527； UniProt 1–527 Author chain Sz； PDBConstruct 1–527； UniProt 1–527

gp9, baseplate wedge tail fiber connector

OrganismNot specified

UniProt A0A7S9SWG4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S9SWG4_BPT4
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain T1； PDBConstruct 1–288； UniProt 1–288 Author chain T2； PDBConstruct 1–288； UniProt 1–288 Author chain T3； PDBConstruct 1–288； UniProt 1–288 Author chain T4； PDBConstruct 1–288； UniProt 1–288 Author chain T5； PDBConstruct 1–288； UniProt 1–288 Author chain T6； PDBConstruct 1–288； UniProt 1–288 Author chain T7； PDBConstruct 1–288； UniProt 1–288 Author chain T8； PDBConstruct 1–288； UniProt 1–288 Author chain T9； PDBConstruct 1–288； UniProt 1–288 Author chain TF； PDBConstruct 1–288； UniProt 1–288 Author chain TG； PDBConstruct 1–288； UniProt 1–288 Author chain TH； PDBConstruct 1–288； UniProt 1–288 Author chain Td； PDBConstruct 1–288； UniProt 1–288 Author chain Te； PDBConstruct 1–288； UniProt 1–288 Author chain Tf； PDBConstruct 1–288； UniProt 1–288 Author chain Tg； PDBConstruct 1–288； UniProt 1–288 Author chain Th； PDBConstruct 1–288； UniProt 1–288 Author chain Ti； PDBConstruct 1–288； UniProt 1–288

gp11, baseplate wedge protein

OrganismNot specified

UniProt A0A7S9SW18

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S9SW18_BPT4
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain UL； PDBConstruct 1–219； UniProt 1–219 Author chain UM； PDBConstruct 1–219； UniProt 1–219 Author chain UN； PDBConstruct 1–219； UniProt 1–219 Author chain Up； PDBConstruct 1–219； UniProt 1–219 Author chain Uq； PDBConstruct 1–219； UniProt 1–219 Author chain Ur； PDBConstruct 1–219； UniProt 1–219 Author chain Us； PDBConstruct 1–219； UniProt 1–219 Author chain Ut； PDBConstruct 1–219； UniProt 1–219 Author chain Uu； PDBConstruct 1–219； UniProt 1–219 Author chain VL； PDBConstruct 1–219； UniProt 1–219 Author chain VM； PDBConstruct 1–219； UniProt 1–219 Author chain VN； PDBConstruct 1–219； UniProt 1–219 Author chain Vp； PDBConstruct 1–219； UniProt 1–219 Author chain Vq； PDBConstruct 1–219； UniProt 1–219 Author chain Vr； PDBConstruct 1–219； UniProt 1–219 Author chain Vs； PDBConstruct 1–219； UniProt 1–219 Author chain Vt； PDBConstruct 1–219； UniProt 1–219 Author chain Vu； PDBConstruct 1–219； UniProt 1–219

gp10, baseplate wedge protein

OrganismNot specified

UniProt P10928

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP10_BPT4
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain WI； PDBConstruct 1–602； UniProt 1–602 Author chain WJ； PDBConstruct 1–602； UniProt 1–602 Author chain WK； PDBConstruct 1–602； UniProt 1–602 Author chain Wj； PDBConstruct 1–602； UniProt 1–602 Author chain Wk； PDBConstruct 1–602； UniProt 1–602 Author chain Wl； PDBConstruct 1–602； UniProt 1–602 Author chain Wm； PDBConstruct 1–602； UniProt 1–602 Author chain Wn； PDBConstruct 1–602； UniProt 1–602 Author chain Wo； PDBConstruct 1–602； UniProt 1–602 Author chain XI； PDBConstruct 1–602； UniProt 1–602 Author chain XJ； PDBConstruct 1–602； UniProt 1–602 Author chain XK； PDBConstruct 1–602； UniProt 1–602 Author chain Xj； PDBConstruct 1–602； UniProt 1–602 Author chain Xk； PDBConstruct 1–602； UniProt 1–602 Author chain Xl； PDBConstruct 1–602； UniProt 1–602 Author chain Xm； PDBConstruct 1–602； UniProt 1–602 Author chain Xn； PDBConstruct 1–602； UniProt 1–602 Author chain Xo； PDBConstruct 1–602； UniProt 1–602

gp7, baseplate wedge protein

OrganismNot specified

UniProt P19061

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP07_BPT4
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain YC； PDBConstruct 1–1032； UniProt 1–1032 Author chain YX； PDBConstruct 1–1032； UniProt 1–1032 Author chain YY； PDBConstruct 1–1032； UniProt 1–1032 Author chain Yc； PDBConstruct 1–1032； UniProt 1–1032 Author chain Yx； PDBConstruct 1–1032； UniProt 1–1032 Author chain Yy； PDBConstruct 1–1032； UniProt 1–1032

gp8, baseplate wedge protein

OrganismNot specified

UniProt A0A7S9SVZ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S9SVZ9_BPT4
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain ZD； PDBConstruct 1–334； UniProt 1–334 Author chain ZE； PDBConstruct 1–334； UniProt 1–334 Author chain ZZ； PDBConstruct 1–334； UniProt 1–334 Author chain Za； PDBConstruct 1–334； UniProt 1–334 Author chain Zb； PDBConstruct 1–334； UniProt 1–334 Author chain Zc； PDBConstruct 1–334； UniProt 1–334 Author chain aD； PDBConstruct 1–334； UniProt 1–334 Author chain aE； PDBConstruct 1–334； UniProt 1–334 Author chain aZ； PDBConstruct 1–334； UniProt 1–334 Author chain aa； PDBConstruct 1–334； UniProt 1–334 Author chain ab； PDBConstruct 1–334； UniProt 1–334 Author chain ac； PDBConstruct 1–334； UniProt 1–334

gp18, tail sheath protein

OrganismNot specified

UniProt A0A7S9SVW9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S9SVW9_BPT4
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain b0； PDBConstruct 1–659； UniProt 1–659 Author chain b3； PDBConstruct 1–659； UniProt 1–659 Author chain b4； PDBConstruct 1–659； UniProt 1–659 Author chain b5； PDBConstruct 1–659； UniProt 1–659 Author chain b6； PDBConstruct 1–659； UniProt 1–659 Author chain b7； PDBConstruct 1–659； UniProt 1–659 Author chain b8； PDBConstruct 1–659； UniProt 1–659 Author chain b9； PDBConstruct 1–659； UniProt 1–659 Author chain bN； PDBConstruct 1–659； UniProt 1–659 Author chain bO； PDBConstruct 1–659； UniProt 1–659 Author chain bP； PDBConstruct 1–659； UniProt 1–659 Author chain bQ； PDBConstruct 1–659； UniProt 1–659 Author chain bR； PDBConstruct 1–659； UniProt 1–659 Author chain bY； PDBConstruct 1–659； UniProt 1–659 Author chain cA； PDBConstruct 1–659； UniProt 1–659 Author chain cB； PDBConstruct 1–659； UniProt 1–659 Author chain cC； PDBConstruct 1–659； UniProt 1–659 Author chain cD； PDBConstruct 1–659； UniProt 1–659 Author chain cE； PDBConstruct 1–659； UniProt 1–659 Author chain cF； PDBConstruct 1–659； UniProt 1–659 Author chain cG； PDBConstruct 1–659； UniProt 1–659 Author chain cH； PDBConstruct 1–659； UniProt 1–659 Author chain cI； PDBConstruct 1–659； UniProt 1–659 Author chain cJ； PDBConstruct 1–659； UniProt 1–659 Author chain cK； PDBConstruct 1–659； UniProt 1–659 Author chain cL； PDBConstruct 1–659； UniProt 1–659 Author chain cM； PDBConstruct 1–659； UniProt 1–659 Author chain cN； PDBConstruct 1–659； UniProt 1–659 Author chain cO； PDBConstruct 1–659； UniProt 1–659 Author chain cP； PDBConstruct 1–659； UniProt 1–659 Author chain dS； PDBConstruct 1–659； UniProt 1–659 Author chain dT； PDBConstruct 1–659； UniProt 1–659 Author chain dU； PDBConstruct 1–659； UniProt 1–659 Author chain dV； PDBConstruct 1–659； UniProt 1–659 Author chain dW； PDBConstruct 1–659； UniProt 1–659 Author chain dZ； PDBConstruct 1–659； UniProt 1–659

gp6, baseplate wedge protein

OrganismNot specified

UniProt P19060

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP06_BPT4
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain eB； PDBConstruct 1–660； UniProt 1–660 Author chain eU； PDBConstruct 1–660； UniProt 1–660 Author chain eW； PDBConstruct 1–660； UniProt 1–660 Author chain f9； PDBConstruct 1–660； UniProt 1–660 Author chain fA； PDBConstruct 1–660； UniProt 1–660 Author chain fB； PDBConstruct 1–660； UniProt 1–660 Author chain fR； PDBConstruct 1–660； UniProt 1–660 Author chain fS； PDBConstruct 1–660； UniProt 1–660 Author chain fU； PDBConstruct 1–660； UniProt 1–660 Author chain fW； PDBConstruct 1–660； UniProt 1–660 Author chain fr； PDBConstruct 1–660； UniProt 1–660 Author chain fs； PDBConstruct 1–660； UniProt 1–660

gp5, baseplate central spike protein

OrganismNot specified

UniProt A0A7S9SVH6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S9SVH6_BPT4
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain gE； PDBConstruct 1–575； UniProt 1–575 Author chain gG； PDBConstruct 1–575； UniProt 1–575 Author chain gH； PDBConstruct 1–575； UniProt 1–575

gp5.4, tip of the central spike

OrganismNot specified

UniProt A0A7S9SVS3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S9SVS3_BPT4
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain gd； PDBConstruct 1–97； UniProt 1–97

gp19, tail tube protein

OrganismNot specified

UniProt A0A7S9SVI2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S9SVI2_BPT4
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain h1； PDBConstruct 1–163； UniProt 1–163 Author chain h2； PDBConstruct 1–163； UniProt 1–163 Author chain hI； PDBConstruct 1–163； UniProt 1–163 Author chain hJ； PDBConstruct 1–163； UniProt 1–163 Author chain hK； PDBConstruct 1–163； UniProt 1–163 Author chain hL； PDBConstruct 1–163； UniProt 1–163 Author chain hM； PDBConstruct 1–163； UniProt 1–163 Author chain hX； PDBConstruct 1–163； UniProt 1–163 Author chain he； PDBConstruct 1–163； UniProt 1–163 Author chain hf； PDBConstruct 1–163； UniProt 1–163 Author chain hg； PDBConstruct 1–163； UniProt 1–163 Author chain hh； PDBConstruct 1–163； UniProt 1–163 Author chain hi； PDBConstruct 1–163； UniProt 1–163 Author chain hj； PDBConstruct 1–163； UniProt 1–163 Author chain hk； PDBConstruct 1–163； UniProt 1–163 Author chain hl； PDBConstruct 1–163； UniProt 1–163 Author chain hm； PDBConstruct 1–163； UniProt 1–163 Author chain hn； PDBConstruct 1–163； UniProt 1–163 Author chain ho； PDBConstruct 1–163； UniProt 1–163 Author chain hp； PDBConstruct 1–163； UniProt 1–163 Author chain hq； PDBConstruct 1–163； UniProt 1–163 Author chain hr； PDBConstruct 1–163； UniProt 1–163 Author chain hs； PDBConstruct 1–163； UniProt 1–163 Author chain ht； PDBConstruct 1–163； UniProt 1–163 Author chain hu； PDBConstruct 1–163； UniProt 1–163 Author chain hv； PDBConstruct 1–163； UniProt 1–163 Author chain hw； PDBConstruct 1–163； UniProt 1–163 Author chain hx； PDBConstruct 1–163； UniProt 1–163 Author chain hy； PDBConstruct 1–163； UniProt 1–163 Author chain hz； PDBConstruct 1–163； UniProt 1–163

gp27, baseplate hub protein

OrganismNot specified

UniProt A0A7S9XHP4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S9XHP4_BPT4
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain iC； PDBConstruct 1–391； UniProt 1–391 Author chain iD； PDBConstruct 1–391； UniProt 1–391 Author chain iF； PDBConstruct 1–391； UniProt 1–391

gp29, tape measure protein

OrganismNot specified

UniProt P13337

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TMP_BPT4
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain ja； PDBConstruct 1–590； UniProt 1–590 Author chain jb； PDBConstruct 1–590； UniProt 1–590 Author chain jc； PDBConstruct 1–590； UniProt 1–590

gp53, baseplate wedge protein

OrganismNot specified

UniProt A0A7S9XI21

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S9XI21_BPT4
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain k3； PDBConstruct 1–196； UniProt 1–196 Author chain k4； PDBConstruct 1–196； UniProt 1–196 Author chain k7； PDBConstruct 1–196； UniProt 1–196 Author chain k8； PDBConstruct 1–196； UniProt 1–196 Author chain kV； PDBConstruct 1–196； UniProt 1–196 Author chain lV； PDBConstruct 1–196； UniProt 1–196

gp25, baseplate wedge protein

OrganismNot specified

UniProt A0A7S9SW44

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp48, baseplate protein × 6 （A0A7S9SVT9） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S9SW44_BPT4
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain m1； PDBConstruct 1–132； UniProt 1–132 Author chain m2； PDBConstruct 1–132； UniProt 1–132 Author chain m5； PDBConstruct 1–132； UniProt 1–132 Author chain m6； PDBConstruct 1–132； UniProt 1–132 Author chain mT； PDBConstruct 1–132； UniProt 1–132 Author chain nT； PDBConstruct 1–132； UniProt 1–132

gp48, baseplate protein

OrganismNot specified

UniProt A0A7S9SVT9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp54, baseplate protein × 6 （P13341） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S9SVT9_BPT4
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain o0； PDBConstruct 1–364； UniProt 1–364 Author chain o1； PDBConstruct 1–364； UniProt 1–364 Author chain o2； PDBConstruct 1–364； UniProt 1–364 Author chain o6； PDBConstruct 1–364； UniProt 1–364 Author chain pA； PDBConstruct 1–364； UniProt 1–364 Author chain pB； PDBConstruct 1–364； UniProt 1–364

gp54, baseplate protein

OrganismNot specified

UniProt P13341

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 220	gp12, short tail fiber protein × 18 （P10930） gp9, baseplate wedge tail fiber connector × 18 （A0A7S9SWG4） gp11, baseplate wedge protein × 18 （A0A7S9SW18） gp10, baseplate wedge protein × 18 （P10928） gp7, baseplate wedge protein × 6 （P19061） gp8, baseplate wedge protein × 12 （A0A7S9SVZ9） gp18, tail sheath protein × 36 （A0A7S9SVW9） gp6, baseplate wedge protein × 12 （P19060） gp5, baseplate central spike protein × 3 （A0A7S9SVH6） gp5.4, tip of the central spike × 1 （A0A7S9SVS3） gp19, tail tube protein × 30 （A0A7S9SVI2） gp27, baseplate hub protein × 3 （A0A7S9XHP4） gp29, tape measure protein × 3 （P13337） gp53, baseplate wedge protein × 6 （A0A7S9XI21） gp25, baseplate wedge protein × 6 （A0A7S9SW44） gp48, baseplate protein × 6 （A0A7S9SVT9） unassigned peptide A × 6 unassigned peptide B × 3 unassigned peptide C × 3 unassigned peptide D × 3 unassigned peptide E × 3 ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP54_BPT4
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain q3； PDBConstruct 1–320； UniProt 1–320 Author chain q4； PDBConstruct 1–320； UniProt 1–320 Author chain q5； PDBConstruct 1–320； UniProt 1–320 Author chain q7； PDBConstruct 1–320； UniProt 1–320 Author chain q8； PDBConstruct 1–320； UniProt 1–320 Author chain q9； PDBConstruct 1–320； UniProt 1–320

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9mog
Deposition date deposition_date	2024-12-26
Structure title title	Structure of the distal part of the bacteriophage T4 tail
Keywords keywords	bacteriophage T4, contractile tail, baseplate, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9mog__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9mog__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9mog__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	181.40 Å
Total Rg	181.40 Å
Atom count	652117
Residues	84090
Excluded volume	11524000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9mog__assembly_1__model_1`	220-meric （220）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (23)

Entity 1 Entity 1 polymer

Description description	gp12, short tail fiber protein
Molecular weight formula_weight	56253.9 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S0,S1,S2,S3,S4,S5,S6,S7,S8,SA,SO,SP,SQ,Sv,Sw,Sx,Sy,Sz
Atom count atom_count	652117

MSNNTYQHVSNESRYVKFDPTDTNFPPEITDVQAAIAAISPAGVNGVPDASSTTKGILFIPTEQEVIDGTNNTKAVTPATLATRLSYPNATETVYGLTRYSTNDEAIAGVNNESSITPAKFTVALNNAFETRVSTESSNGVIKISSLPQALAGADDTTAMTPLKTQQLAIKLIAQIAPSETTATESDQGVVQLATVAQVRQGTLREGYAISPYTFMNSSSTEEYKGVIKLGTQSEVNSNNASVAVTGATLNGRGSTTSMRGVVKLTTTAGSQSGGDASSALAWNADVIQQRGGQIIYGTLRIEDTFTIANGGANITGTVRMTGGYIQGNRIVTQNEIDRTIPVGAIMMWAADSLPSDAWRFCHGGTVSASDCPLYASRIGTRYGGNPSNPGLPDMRGLFVRGSGRGSHLTNPNVNGNDQFGKPRLGVGCTGGYVGEVQIQQMSYHKHAGGFGEHDDLGAFGNTRRSNFVGTRKGLDWDNRSYFTNDGYEIDPESQRNSKYTLNRPELIGNETRPWNISLNYIIKVKE

Entity 2 Entity 2 polymer

Description description	gp9, baseplate wedge tail fiber connector
Molecular weight formula_weight	31024.7 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T1,T2,T3,T4,T5,T6,T7,T8,T9,TF,TG,TH,Td,Te,Tf,Tg,Th,Ti

MFIQEPKKLIDTGEIGNASTGDILFDGGNKINSDFNAIYNAFGDQRKMAVANGTGADGQIIHATGYYQKHSITEYATPVKVGTRHDIDTSTVGVKVIIERGELGDCVEFINSNGSISVTNPLTIQAIDSIKGVSGNLVVTSPYSKVTLRCISSDNSTSVWNYSIESMFGQKESPAEGTWNISTSGSVDIPLFHRTEYNMAKLLVTCQSVDGRKIKTAEINILVDTVNSEVISSEYAVMRVGNETEEDEIANIAFSIKENYVTATISSSTVGMRAAVKVIATQKIGVAQ

Entity 3 Entity 3 polymer

Description description	gp11, baseplate wedge protein
Molecular weight formula_weight	23725.5 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	UL,UM,UN,Up,Uq,Ur,Us,Ut,Uu,VL,VM,VN,Vp,Vq,Vr,Vs,Vt,Vu

MSLLNNKAGVISRLADFLGFRPKTGDIDVMNRQSVGSVTISQLAKGFYEPNIESAINDVHNFSIKDVGTIITNKTGVSPEGVSQTDYWAFSGTVTDDSLPPGSPITVLVFGLPVSATTGMTAIEFVAKVRVALQEAIASFTAINSYKDHPTDGSKLEVTYLDNQKHVLSTYSTYGITISQEIISESKPGYGTWNLLGAQTVTLDNQQTPTVFYHFERTA

Entity 4 Entity 4 polymer

Description description	gp10, baseplate wedge protein
Molecular weight formula_weight	66281.7 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	WI,WJ,WK,Wj,Wk,Wl,Wm,Wn,Wo,XI,XJ,XK,Xj,Xk,Xl,Xm,Xn,Xo

MKQNINIGNVVDDGTGDYLRKGGIKINENFDELYYELGDGDVPYSAGAWKTYNASSGQTLTAEWGKSYAINTSSGRVTINLPKGTVNDYNKVIRARDVFATWNVNPVTLVAASGDTIKGSAVPVEINVRFSDLELVYCAPGRWEYVKNKQIDKITSSDISNVARKEFLVEVQGQTDFLDVFRGTSYNVNNIRVKHRGNELYYGDVFSENSDFGSPGENEGELVPLDGFNIRLRQPCNIGDTVQIETFMDGVSQWRSSYTRRQIRLLDSKLTSKTSLEGSIYVTDLSTMKSIPFSAFGLIPGEPINPNSLEVRFNGILQELAGTVGMPLFHCVGADSDDEVECSVLGGTWEQSHTDYSVETDENGIPEILHFDSVFEHGDIINITWFNNDLGTLLTKDEIIDETDNLYVSQGPGVDISGDVNLTDFDKIGWPNVEAVQSYQRAFNAVSNIFDTIYPIGTIYENAVNPNNPVTYMGFGSWKLFGQGKVLVGWNEDISDPNFALNNNDLDSGGNPSHTAGGTGGSTSVTLENANLPATETDEEVLIVDENGSVIVGGCQYDPDESGPIYTKYREAKASTNSTHTPPTSITNIQPYITVYRWIRIA

Entity 5 Entity 5 polymer

Description description	gp7, baseplate wedge protein
Molecular weight formula_weight	119336.5 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	YC,YX,YY,Yc,Yx,Yy

MTVKAPSVTSLRISKLSANQVQVRWDDVGANFYYFVEIAETKTNSGENLPSNQYRWINLGYTANNSFFFDDADPLTTYIIRVATAAQDFEQSDWIYTEEFETFATNAYTFQNMIEMQLANKFIQEKFTLNNSDYVNFNNDTIMAALMNESFQFSPSYVDVSSISNFIIGENEYHEIQGSIQQVCKDINRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVYYQSANTTYVLGYDKIFYGRKSTDVRWSADDVRFSSQDITFAKLGDQLHLGFDVEIFATYATLPANVYRIAEAITCTDDYIYVVARDKVRYIKTSNALIDFDPLSPTYSERLFEPDTMTITGNPKAVCYKMDSICDKVFALIIGEVETLNANPRTSKIIDSADKGIYVLNHDEKTWKRVFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLSDNVVNDPETAAKYQLIGAVKYEFPREWLADKHYHMMAFIADETSDWETFTPQPMKYYAEPFFNWSKKSNTRCWINNSDRAVVVYADLKYTKVIENIPETSPDRLVHEYWDDGDCTIVMPNVKFTGFKKYASGMLFYKASGEIISYYDFNYRVRDTVEIIWKPTEVFLKAFLQNQEHETPWSPEEERGLADPDLRPLIGTMMPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNQYPREEHAWEYLWSEIYKRNIYLNADKRDAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDIIVQSDSLTEDLVGQTIYTATGRCNVTYIERSYSNGKLQWTVTIHNLLGRLIAGQEVKAERLPSFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVIRFVHPVGFGFIAITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRIAKLTPTGEIEHDSVTGEAIYEPGPMAGVKYPLPDDYNAENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRLKDNIGNPRDPENPTQVKIDE

Entity 6 Entity 6 polymer

Description description	gp8, baseplate wedge protein
Molecular weight formula_weight	38041.7 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	ZD,ZE,ZZ,Za,Zb,Zc,aD,aE,aZ,aa,ab,ac

MNDSSVIYRAIVTSKFRTEKMLNFYNSIGSGPDKNTIFITFGRSEPWSSNENEVGFAPPYPTDSVLGVTDMWTHMMGTVKVLPSMLDAVIPRRDWGDTRYPDPYTFRINDIVVCNSAPYNATESGAGWLVYRCLDVPDTGMCSIASLTDKDECLKLGGKWTPSARSMTPPEGRGDAEGTIEPGDGYVWEYLFEIPPDVSINRCTNEYIVVPWPEELKEDPTRWGYEDNLTWQQDDFGLIYRVKANTIRFKAYLDSVYFPEAALPGNKGFRQISIITNPLEAKAHPNDPNVKAEKDYYDPEDLMRHSGEMIYMENRPPIIMAMDQTEEINILFTF

Entity 7 Entity 7 polymer

Description description	gp18, tail sheath protein
Molecular weight formula_weight	71348.6 kDa
Source method src_method	nat
Copy count entity_count	36

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b0,b3,b4,b5,b6,b7,b8,b9,bN,bO,bP,bQ,bR,bY,cA,cB,cC,cD,cE,cF,cG,cH,cI,cJ,cK,cL,cM,cN,cO,cP,dS,dT,dU,dV,dW,dZ

MTLLSPGIELKETTVQSTVVNNSTGTAALAGKFQWGPAFQIKQVTNEVDLVNTFGQPTAETADYFMSAMNFLQYGNDLRVVRAVDRDTAKNSSPIAGNIEYTISTPGSNYAVGDKITVKYVSDDIETEGKITEVDADGKIKKINIPTAKIIAKAKEVGEYPTLGSNWTAEISSSSSGLAAVITLGKIITDSGILLAEIENAEAAMTAVDFQANLKKYGIPGVVALYPGELGDKIEIEIVSKADYAKGASALLPIYPGGGTRASTAKAVFGYGPQTDSQYAIIVRRNDAIVQSVVLSTKRGGKDIYDSNIYIDDFFAKGGSEYIFATAQNWPEGFSGILTLSGGLSSNAEVTAGDLMEAWDFFADRESVDVQLFIAGSCAGESLETASTVQKHVVSIGDVRQDCLVLCSPPRETVVGIPVTRAVDNLVNWRTAAGSYTDNNFNISSTYAAIDGNYKYQYDKYNDVNRWVPLAADIAGLCARTDNVSQTWMSPAGYNRGQILNVIKLAIETRQAQRDRLYQEAINPVTGTGGDGYVLYGDKTATSVPSPFDRINVRRLFNMLKTNIGRSSKYRLFELNNAFTRSSFRTETAQYLQGIKALGGIYEYRVVCDTTNNTPSVIDRNEFVATFYIQPARSINYITLNFVATATGADFDELTGLAG

Entity 8 Entity 8 polymer

Description description	gp6, baseplate wedge protein
Molecular weight formula_weight	74492.6 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	eB,eU,eW,f9,fA,fB,fR,fS,fU,fW,fr,fs

MANTPVNYQLTRTANAIPEIFVGGTFAEIKQNLIEWLNGQNEFLDYDFEGSRLNVLCDLLAYNTLYIQQFGNAAVYESFMRTANLRSSVVQAAQDNGYLPTSKSAAQTEIMLTCTDALNRNYITIPRGTRFLAYAKDTSVNPYNFVSREDVIAIRDKNNQYFPRLKLAQGRIVRTEIIYDKLTPIIIYDKNIDRNQVKLYVDGAEWINWTRKSMVHAGSTSTIYYMRETIDGNTEFYFGEGEISVNASEGALTANYIGGLKPTQNSTIVIEYISTNGADANGAVGFSYADTLTNITVININENPNDDPDFVGADGGGDPEDIERIRELGTIKRETQQRCVTATDYDTFVSERFGSIIQAVQTFTDSTKPGYAFIAAKPKSGLYLTTVQREDIKNYLKDYNLAPITPSIISPNYLFIKTNLKVTYALNKLQESEQWLEGQIIDKIDRYYTEDVEIFNSSFAKSKMLTYVDDADHSVIGSSATIQMVREVQNFYKTPEAGIKYNNQIKDRSMESNTFSFNSGRKVVNPDTGLEEDVLYDVRIVSTDRDSKGIGKVIIGPFASGDVTENENIQPYTGNDFNKLANSDGRDKYYVIGEINYPADVIYWNIAKINLTSEKFEVQTIELYSDPTDDVIFTRDGSLIVFENDLRPQYLTIDLEPISQ

Entity 9 Entity 9 polymer

Description description	gp5, baseplate central spike protein
Molecular weight formula_weight	63183.7 kDa
EC 编号 ec_number	3.2.1.17
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	gE,gG,gH

MEMISNNLNWFVGVVEDRMDPLKLGRVRVRVVGLHPPQRAQGDVMGIPTEKLPWMSVIQPITSAAMSGIGGSVTGPVEGTRVYGHFLDKWKTNGIVLGTYGGIVREKPNRLEGFSDPTGQYPRRLGNDTNVLNQGGEVGYDSSSNVIQDSNLDTAINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYPTIGIGHLIMKQPVRDMAQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSRQMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKAYKAGRDSLWYQQTKGRASRVTMIILTGNLESYGVEVKTPARSLSAMAATVAKSSDPADPPIPNDSRILFKEPVSSYKGEYPYVHTMETESGHIQEFDDTPGQERYRLVHPTGTYEEVSPSGRRTRKTVDNLYDITNADGNFLVAGDKKTNVGGSEIYYNMDNRLHQIDGSNTIFVRGDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWTEKMASMSSISSGQYTIDGSRIDIG

Entity 10 Entity 10 polymer

Description description	gp5.4, tip of the central spike
Molecular weight formula_weight	10233.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	gd

MSGLSYDKCVTAGHEAWPPTVVNATQSKVFTGGIAVLVAGDPITEHTEIKKPYETHGGVTQPRTSKVYVTGKKAVQMADPISCGDTVAQASSKVFIK

Entity 11 Entity 11 polymer

Description description	gp19, tail tube protein
Molecular weight formula_weight	18479.6 kDa
Source method src_method	nat
Copy count entity_count	30

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h1,h2,hI,hJ,hK,hL,hM,hX,he,hf,hg,hh,hi,hj,hk,hl,hm,hn,ho,hp,hq,hr,hs,ht,hu,hv,hw,hx,hy,hz

MFVDDVTRAFESGDFARPNLFQVEISYLGQNFTFQCKATALPAGIVEKIPVGFMNRKINVAGDRTFDDWTVTVMNDEAHDARQKFVDWQSIAAGQGNEITGGKPAEYKKSAIVRQYARDAKTVTKEIEIKGLWPTNVGELQLDWDSNNEIQTFEVTLALDYWE

Entity 12 Entity 12 polymer

Description description	gp27, baseplate hub protein
Molecular weight formula_weight	44431.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	iC,iD,iF

MSMLQRPGYPNLSVKLFDSYDAWSNNRFVELAATITTLTMRDSLYGRNEGMLQFYDSKNIHTKMDGNEIIQISVANANDINNVKTRIYGCKHFSVSVDSKGDNIIAIELGTIHSIENLKFGRPFFPDAGESIKEMLGVIYQDRTLLTPAINAINAYVPDIPWTSTFENYLSYVREVALAVGSDKFVFVWQDIMGVNMMDYDMMINQEPYPMIVGEPSLIGQFIQELKYPLAYDFVWLTKSNPHKRDPMKNATIYAHSFLDSSIPMITTGKGENSIVVSRSGAYSEMTYRNGYEEAIRLQTMAQYDGYAKCSTIGNFNLTPGVKIIFNDSKNQFKTEFYVDEVIHELSNNNSVTHLYMFTNATKLETIDPVKVKNEFKSDTTTEESSSSNKQ

Entity 13 Entity 13 polymer

Description description	gp29, tape measure protein
Molecular weight formula_weight	64485.5 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	ja,jb,jc

MKKPQEMQTMRRKVISDNKPTQEAAKSASNTLSGLNDISTKLDDAQAASELIAQTVEEKSNEIIGAIDNVESAVSDTSAGSELIAETVEIGNNINKEIGESLGSKLDKLTSLLEQKIQTAGIQQTGTSLATVESAIPVKVVEDDTAESVGPLLPAPEAVNNDPDADFFPTPQPVEPKQESPEEKQKKEAFNLKLSQALDKLTKTVDFGFKKSISITDKISSMLFKYTVSAAIEAAKMTAMILAVVVGIDLLMIHFKYWSDKFSKAWDLFSTDFTKFSSETGTWGPLLQSIFDSIDKIKQLWEAGDWGGLTVAIVEGLGKVLFNLGELIQLGMAKLSAAILRVIPGMKDTADEVEGRALENFQNSTGASLNKEDQEKVANYQDKRMNGDLGPIAEGLDKISNWKTRASNWIRGVDNKEALTTDEERAAEEEKLKQLSPEERKNALMKANEARAAMIRFEKYADSADMSKDSTVKSVEAAYEDLKKRMDDPDLNNSPAVKKELAARFSKIDATYQELKKNQPNAKPETSAKSPEAKQVQVIEKNKAQQAPVQQASPSINNTNNVIKKNTVVHNMTPVTSTTAPGVFDATGVN

Entity 14 Entity 14 polymer

Description description	gp53, baseplate wedge protein
Molecular weight formula_weight	22990.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k3,k4,k7,k8,kV,lV

MLFTFFDPIEYAAKTVNKNAPTIPMTDIFRNYKDYFKRALAGYRLRTYYIKGSPRPEELANAIYGNPQLYWVLLMCNDNYDPYYGWITSQEAAYQASIQKYKNVGGDQIVYHVNENGEKFYNLISYDDNPYVWYDKGDKARKYPQYEGALAAVDTYEAAVLENEKLRQIKIIAKSDINSFMNDLIRIMEKSYGNDK

Entity 15 Entity 15 polymer

Description description	gp25, baseplate wedge protein
Molecular weight formula_weight	15111.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m1,m2,m5,m6,mT,nT

MANINKLYSDIDPEMKMDWNKDVSRSLGLRSIKNSLLGIITTRKGSRPFDPEFGCDLSDQLFENMTPLTADTVERNIESAVRNYEPRIDKLAVNVIPVYDDYTLIVEIRFSVIDNPDDIEQIKLQLASSNRV

Entity 16 Entity 16 polymer

Description description	gp48, baseplate protein
Molecular weight formula_weight	39770.3 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o0,o1,o2,o6,pA,pB

MAIVKEITADLIKKSGEKISAGQSTKSEVGTKTYTAQFPTGRASGNDTTEDFQVTDLYKNGLLFTAYNMSSRDSGSLRSMRSNYSSSSSSILRTARNTISSTVSKLSNGLISNNNSGTISKSPIANILLPRSKSDVDTSSHRFNDVQESLISRGGGTATGVLSNIASTAVFGALESITQGIMADNNEQIYTTARSMYGGAENRTKVFTWDLTPRSTEDLMAIINIYQYFNYFSYGETGKSQYAAEIKGYLDDWYRSTLIEPLSPEDAAKNKTLFEKMTSSLTNVLVVSNPTVWMVKNFGATSKFDGKTEIFGPCQIQSIRFDKTPNGNFNGLAIAPNLPSTFTLEITMREIITLNRASLYAGTF

Entity 17 Entity 17 polymer

Description description	gp54, baseplate protein
Molecular weight formula_weight	35001.2 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q3,q4,q5,q7,q8,q9

MYSLEEFNNQAINADFQRNNMFSCVFATTPSTKSSSLISSISNFSYNNLGLNSDWLGLTQGDINQGITTLITAGTQKLIRKSGVSKYLIGAMSQRTVQSLLGSFTVGTYLIDFFNMAYNSSGLMIYSVKMPENRLSYETDWNYNSPNIRITGRELDPLVISFRMDSEACNYRAMQDWVNSVQDPVTGLRALPQDVEADIQVNLHSRNGLPHTAVMFTMHSISVSAPELSYDGDNQITTFDVTFAYRVMQAGAVDRQRALEWLESAAINGIQSVLGNSGGVTGLSNSLSRLSRLGGTAGSISNINTMTGIVNSQSKILGAI

Entity 18 Entity 18 polymer

Description description	unassigned peptide A
Molecular weight formula_weight	2145.6 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	rc,rd,re,rf,rg,rh

XXXXXXXXXXXXXXXXXXXXXXXXX

Entity 19 Entity 19 polymer

Description description	unassigned peptide B
Molecular weight formula_weight	1549.9 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	sQ,sT,sU

XXXXXXXXXXXXXXXXXX

Entity 20 Entity 20 polymer

Description description	unassigned peptide C
Molecular weight formula_weight	869.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	tS,tX,tY

XXXXXXXXXX

Entity 21 Entity 21 polymer

Description description	unassigned peptide D
Molecular weight formula_weight	613.7 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	uR,uV,uW

XXXXXXX

Entity 22 Entity 22 polymer

Description description	unassigned peptide E
Molecular weight formula_weight	784.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	vZ,va,vb

XXXXXXXXX

Entity 23 Entity 23 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	6

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	113800

Structure of the distal part of the bacteriophage T4 tail

1. Protein Identity and Related Structures Protein Identity & Related Structures

gp12, short tail fiber protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

gp9, baseplate wedge tail fiber connector

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

gp11, baseplate wedge protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

gp10, baseplate wedge protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

gp7, baseplate wedge protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

gp8, baseplate wedge protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

gp18, tail sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

gp6, baseplate wedge protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

gp5, baseplate central spike protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

gp5.4, tip of the central spike

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer