SAXSdb — 9moh

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

gp18, tail sheath protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 162	gp19, tail tube protein × 78 （A0A7S9SVI2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S9SVW9_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain K0； PDBConstruct 1–659； UniProt 1–659 Author chain K1； PDBConstruct 1–659； UniProt 1–659 Author chain K2； PDBConstruct 1–659； UniProt 1–659 Author chain K3； PDBConstruct 1–659； UniProt 1–659 Author chain K4； PDBConstruct 1–659； UniProt 1–659 Author chain K5； PDBConstruct 1–659； UniProt 1–659 Author chain K6； PDBConstruct 1–659； UniProt 1–659 Author chain K7； PDBConstruct 1–659； UniProt 1–659 Author chain K8； PDBConstruct 1–659； UniProt 1–659 Author chain K9； PDBConstruct 1–659； UniProt 1–659 Author chain L0； PDBConstruct 1–659； UniProt 1–659 Author chain L1； PDBConstruct 1–659； UniProt 1–659 Author chain L2； PDBConstruct 1–659； UniProt 1–659 Author chain L3； PDBConstruct 1–659； UniProt 1–659 Author chain L4； PDBConstruct 1–659； UniProt 1–659 Author chain L5； PDBConstruct 1–659； UniProt 1–659 Author chain L6； PDBConstruct 1–659； UniProt 1–659 Author chain L7； PDBConstruct 1–659； UniProt 1–659 Author chain L8； PDBConstruct 1–659； UniProt 1–659 Author chain L9； PDBConstruct 1–659； UniProt 1–659 Author chain LQ； PDBConstruct 1–659； UniProt 1–659 Author chain LR； PDBConstruct 1–659； UniProt 1–659 Author chain LS； PDBConstruct 1–659； UniProt 1–659 Author chain LU； PDBConstruct 1–659； UniProt 1–659 Author chain LV； PDBConstruct 1–659； UniProt 1–659 Author chain LW； PDBConstruct 1–659； UniProt 1–659 Author chain LX； PDBConstruct 1–659； UniProt 1–659 Author chain LY； PDBConstruct 1–659； UniProt 1–659 Author chain LZ； PDBConstruct 1–659； UniProt 1–659 Author chain La； PDBConstruct 1–659； UniProt 1–659 Author chain Lb； PDBConstruct 1–659； UniProt 1–659 Author chain Lc； PDBConstruct 1–659； UniProt 1–659 Author chain Ld； PDBConstruct 1–659； UniProt 1–659 Author chain Le； PDBConstruct 1–659； UniProt 1–659 Author chain Lv； PDBConstruct 1–659； UniProt 1–659 Author chain Lw； PDBConstruct 1–659； UniProt 1–659 Author chain Lx； PDBConstruct 1–659； UniProt 1–659 Author chain Lz； PDBConstruct 1–659； UniProt 1–659 Author chain M0； PDBConstruct 1–659； UniProt 1–659 Author chain M1； PDBConstruct 1–659； UniProt 1–659 Author chain M2； PDBConstruct 1–659； UniProt 1–659 Author chain M3； PDBConstruct 1–659； UniProt 1–659 Author chain M4； PDBConstruct 1–659； UniProt 1–659 Author chain M5； PDBConstruct 1–659； UniProt 1–659 Author chain M6； PDBConstruct 1–659； UniProt 1–659 Author chain M7； PDBConstruct 1–659； UniProt 1–659 Author chain M8； PDBConstruct 1–659； UniProt 1–659 Author chain M9； PDBConstruct 1–659； UniProt 1–659 Author chain MQ； PDBConstruct 1–659； UniProt 1–659 Author chain MR； PDBConstruct 1–659； UniProt 1–659 Author chain MS； PDBConstruct 1–659； UniProt 1–659 Author chain MU； PDBConstruct 1–659； UniProt 1–659 Author chain MV； PDBConstruct 1–659； UniProt 1–659 Author chain MW； PDBConstruct 1–659； UniProt 1–659 Author chain MX； PDBConstruct 1–659； UniProt 1–659 Author chain MY； PDBConstruct 1–659； UniProt 1–659 Author chain MZ； PDBConstruct 1–659； UniProt 1–659 Author chain Ma； PDBConstruct 1–659； UniProt 1–659 Author chain Mb； PDBConstruct 1–659； UniProt 1–659 Author chain Mc； PDBConstruct 1–659； UniProt 1–659 Author chain Md； PDBConstruct 1–659； UniProt 1–659 Author chain Me； PDBConstruct 1–659； UniProt 1–659 Author chain Mv； PDBConstruct 1–659； UniProt 1–659 Author chain Mw； PDBConstruct 1–659； UniProt 1–659 Author chain Mx； PDBConstruct 1–659； UniProt 1–659 Author chain Mz； PDBConstruct 1–659； UniProt 1–659 Author chain NV； PDBConstruct 1–659； UniProt 1–659 Author chain NW； PDBConstruct 1–659； UniProt 1–659 Author chain NX； PDBConstruct 1–659； UniProt 1–659 Author chain NZ； PDBConstruct 1–659； UniProt 1–659 Author chain Na； PDBConstruct 1–659； UniProt 1–659 Author chain Nb； PDBConstruct 1–659； UniProt 1–659 Author chain Nc； PDBConstruct 1–659； UniProt 1–659 Author chain Nd； PDBConstruct 1–659； UniProt 1–659 Author chain Ne； PDBConstruct 1–659； UniProt 1–659 Author chain Nf； PDBConstruct 1–659； UniProt 1–659 Author chain Ng； PDBConstruct 1–659； UniProt 1–659 Author chain Nh； PDBConstruct 1–659； UniProt 1–659 Author chain Ni； PDBConstruct 1–659； UniProt 1–659 Author chain Nj； PDBConstruct 1–659； UniProt 1–659 Author chain Nv； PDBConstruct 1–659； UniProt 1–659 Author chain Nw； PDBConstruct 1–659； UniProt 1–659 Author chain Nx； PDBConstruct 1–659； UniProt 1–659 Author chain Nz； PDBConstruct 1–659； UniProt 1–659

gp19, tail tube protein

OrganismNot specified

UniProt A0A7S9SVI2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 162	gp18, tail sheath protein × 84 （A0A7S9SVW9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7S9SVI2_BPT4
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain OC； PDBConstruct 1–163； UniProt 1–163 Author chain OD； PDBConstruct 1–163； UniProt 1–163 Author chain OE； PDBConstruct 1–163； UniProt 1–163 Author chain OF； PDBConstruct 1–163； UniProt 1–163 Author chain OG； PDBConstruct 1–163； UniProt 1–163 Author chain OH； PDBConstruct 1–163； UniProt 1–163 Author chain OI； PDBConstruct 1–163； UniProt 1–163 Author chain OJ； PDBConstruct 1–163； UniProt 1–163 Author chain OK； PDBConstruct 1–163； UniProt 1–163 Author chain OL； PDBConstruct 1–163； UniProt 1–163 Author chain OM； PDBConstruct 1–163； UniProt 1–163 Author chain ON； PDBConstruct 1–163； UniProt 1–163 Author chain OO； PDBConstruct 1–163； UniProt 1–163 Author chain Oh； PDBConstruct 1–163； UniProt 1–163 Author chain Oi； PDBConstruct 1–163； UniProt 1–163 Author chain Oj； PDBConstruct 1–163； UniProt 1–163 Author chain Ok； PDBConstruct 1–163； UniProt 1–163 Author chain Ol； PDBConstruct 1–163； UniProt 1–163 Author chain Om； PDBConstruct 1–163； UniProt 1–163 Author chain On； PDBConstruct 1–163； UniProt 1–163 Author chain Oo； PDBConstruct 1–163； UniProt 1–163 Author chain Op； PDBConstruct 1–163； UniProt 1–163 Author chain Oq； PDBConstruct 1–163； UniProt 1–163 Author chain Or； PDBConstruct 1–163； UniProt 1–163 Author chain Os； PDBConstruct 1–163； UniProt 1–163 Author chain Ot； PDBConstruct 1–163； UniProt 1–163 Author chain PC； PDBConstruct 1–163； UniProt 1–163 Author chain PD； PDBConstruct 1–163； UniProt 1–163 Author chain PE； PDBConstruct 1–163； UniProt 1–163 Author chain PF； PDBConstruct 1–163； UniProt 1–163 Author chain PG； PDBConstruct 1–163； UniProt 1–163 Author chain PH； PDBConstruct 1–163； UniProt 1–163 Author chain PI； PDBConstruct 1–163； UniProt 1–163 Author chain PJ； PDBConstruct 1–163； UniProt 1–163 Author chain PK； PDBConstruct 1–163； UniProt 1–163 Author chain PL； PDBConstruct 1–163； UniProt 1–163 Author chain PM； PDBConstruct 1–163； UniProt 1–163 Author chain PN； PDBConstruct 1–163； UniProt 1–163 Author chain PO； PDBConstruct 1–163； UniProt 1–163 Author chain Ph； PDBConstruct 1–163； UniProt 1–163 Author chain Pi； PDBConstruct 1–163； UniProt 1–163 Author chain Pj； PDBConstruct 1–163； UniProt 1–163 Author chain Pk； PDBConstruct 1–163； UniProt 1–163 Author chain Pl； PDBConstruct 1–163； UniProt 1–163 Author chain Pm； PDBConstruct 1–163； UniProt 1–163 Author chain Pn； PDBConstruct 1–163； UniProt 1–163 Author chain Po； PDBConstruct 1–163； UniProt 1–163 Author chain Pp； PDBConstruct 1–163； UniProt 1–163 Author chain Pq； PDBConstruct 1–163； UniProt 1–163 Author chain Pr； PDBConstruct 1–163； UniProt 1–163 Author chain Ps； PDBConstruct 1–163； UniProt 1–163 Author chain Pt； PDBConstruct 1–163； UniProt 1–163 Author chain RC； PDBConstruct 1–163； UniProt 1–163 Author chain RD； PDBConstruct 1–163； UniProt 1–163 Author chain RE； PDBConstruct 1–163； UniProt 1–163 Author chain RF； PDBConstruct 1–163； UniProt 1–163 Author chain RG； PDBConstruct 1–163； UniProt 1–163 Author chain RH； PDBConstruct 1–163； UniProt 1–163 Author chain RI； PDBConstruct 1–163； UniProt 1–163 Author chain RJ； PDBConstruct 1–163； UniProt 1–163 Author chain RK； PDBConstruct 1–163； UniProt 1–163 Author chain RL； PDBConstruct 1–163； UniProt 1–163 Author chain RM； PDBConstruct 1–163； UniProt 1–163 Author chain RN； PDBConstruct 1–163； UniProt 1–163 Author chain RO； PDBConstruct 1–163； UniProt 1–163 Author chain RR； PDBConstruct 1–163； UniProt 1–163 Author chain RS； PDBConstruct 1–163； UniProt 1–163 Author chain RT； PDBConstruct 1–163； UniProt 1–163 Author chain Rk； PDBConstruct 1–163； UniProt 1–163 Author chain Rl； PDBConstruct 1–163； UniProt 1–163 Author chain Rm； PDBConstruct 1–163； UniProt 1–163 Author chain Rn； PDBConstruct 1–163； UniProt 1–163 Author chain Ro； PDBConstruct 1–163； UniProt 1–163 Author chain Rp； PDBConstruct 1–163； UniProt 1–163 Author chain Rq； PDBConstruct 1–163； UniProt 1–163 Author chain Rr； PDBConstruct 1–163； UniProt 1–163 Author chain Rs； PDBConstruct 1–163； UniProt 1–163 Author chain Rt； PDBConstruct 1–163； UniProt 1–163

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9moh
Deposition date deposition_date	2024-12-26
Structure title title	Structure of the middle part of the bacteriophage T4 tail
Keywords keywords	bacteriophage T4, contractile phage tail, sheath protein, tail tube protein, VIRUS, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9moh__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9moh__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9moh__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	174.20 Å
Total Rg	174.20 Å
Atom count	521712
Residues	67734
Excluded volume	9243400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9moh__assembly_1__model_1`	162-meric （162）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	gp18, tail sheath protein
Molecular weight formula_weight	71348.6 kDa
Source method src_method	nat
Copy count entity_count	84

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;K0,K1,K2,K3,K4,K5,K6,K7,K8,K9,L0,L1,L2,L3,L4,L5,L6,L7,L8,L9,LQ,LR,LS,LU,LV,LW,LX,LY,LZ,La,Lb,Lc,Ld,Le,Lv,Lw,Lx,Lz,M0,M1,M2,M3,M4,M5,M6,M7,M8,M9,MQ,MR,MS,MU,MV,MW,MX,MY,MZ,Ma,Mb,Mc,Md,Me,Mv,Mw,Mx,Mz,NV,NW,NX,NZ,Na,Nb,Nc,Nd,Ne,Nf,Ng,Nh,Ni,Nj,Nv,Nw,Nx,Nz ;
Atom count atom_count	521712

MTLLSPGIELKETTVQSTVVNNSTGTAALAGKFQWGPAFQIKQVTNEVDLVNTFGQPTAETADYFMSAMNFLQYGNDLRVVRAVDRDTAKNSSPIAGNIEYTISTPGSNYAVGDKITVKYVSDDIETEGKITEVDADGKIKKINIPTAKIIAKAKEVGEYPTLGSNWTAEISSSSSGLAAVITLGKIITDSGILLAEIENAEAAMTAVDFQANLKKYGIPGVVALYPGELGDKIEIEIVSKADYAKGASALLPIYPGGGTRASTAKAVFGYGPQTDSQYAIIVRRNDAIVQSVVLSTKRGGKDIYDSNIYIDDFFAKGGSEYIFATAQNWPEGFSGILTLSGGLSSNAEVTAGDLMEAWDFFADRESVDVQLFIAGSCAGESLETASTVQKHVVSIGDVRQDCLVLCSPPRETVVGIPVTRAVDNLVNWRTAAGSYTDNNFNISSTYAAIDGNYKYQYDKYNDVNRWVPLAADIAGLCARTDNVSQTWMSPAGYNRGQILNVIKLAIETRQAQRDRLYQEAINPVTGTGGDGYVLYGDKTATSVPSPFDRINVRRLFNMLKTNIGRSSKYRLFELNNAFTRSSFRTETAQYLQGIKALGGIYEYRVVCDTTNNTPSVIDRNEFVATFYIQPARSINYITLNFVATATGADFDELTGLAG

Entity 2 Entity 2 polymer

Description description	gp19, tail tube protein
Molecular weight formula_weight	18479.6 kDa
Source method src_method	nat
Copy count entity_count	78

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;OC,OD,OE,OF,OG,OH,OI,OJ,OK,OL,OM,ON,OO,Oh,Oi,Oj,Ok,Ol,Om,On,Oo,Op,Oq,Or,Os,Ot,PC,PD,PE,PF,PG,PH,PI,PJ,PK,PL,PM,PN,PO,Ph,Pi,Pj,Pk,Pl,Pm,Pn,Po,Pp,Pq,Pr,Ps,Pt,RC,RD,RE,RF,RG,RH,RI,RJ,RK,RL,RM,RN,RO,RR,RS,RT,Rk,Rl,Rm,Rn,Ro,Rp,Rq,Rr,Rs,Rt ;

MFVDDVTRAFESGDFARPNLFQVEISYLGQNFTFQCKATALPAGIVEKIPVGFMNRKINVAGDRTFDDWTVTVMNDEAHDARQKFVDWQSIAAGQGNEITGGKPAEYKKSAIVRQYARDAKTVTKEIEIKGLWPTNVGELQLDWDSNNEIQTFEVTLALDYWE

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	113800

Structure of the middle part of the bacteriophage T4 tail

1. Protein Identity and Related Structures Protein Identity & Related Structures

gp18, tail sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

gp19, tail tube protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9moh__assembly_1__model_1

9moh__assembly_1__model_1 | I(q)

9moh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (1)

Structure of the middle part of the bacteriophage T4 tail

1. Protein Identity and Related Structures Protein Identity & Related Structures

gp18, tail sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

gp19, tail tube protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9moh__assembly_1__model_1

9moh__assembly_1__model_1 | I(q)

9moh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (1)