9mu8

Structure of a native Drosophila melanogaster Pol II Elongation Complex without Rpb4/Rpb7 stalk

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit RPB1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	DNA-directed RNA polymerase II subunit RPB2 × 1 （P08266） DNA-directed RNA polymerase II subunit RPB3 × 1 （O97183） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （Q24320） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q9VNZ3） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36958） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （Q9VC49） DNA-directed RNA polymerase II subunit RPB11 × 1 （Q9VJE4） DNA-directed RNA polymerase II subunit RPB12 × 1 （Q6IGE3） RNA × 1 Template DNA × 1 Non-template DNA × 1 RPB5 homolog × 1 （Q7JZF5） ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB1_DROME
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1470； UniProt 7–1476

DNA-directed RNA polymerase II subunit RPB2

OrganismNot specified

UniProt P08266

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04052） DNA-directed RNA polymerase II subunit RPB3 × 1 （O97183） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （Q24320） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q9VNZ3） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36958） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （Q9VC49） DNA-directed RNA polymerase II subunit RPB11 × 1 （Q9VJE4） DNA-directed RNA polymerase II subunit RPB12 × 1 （Q6IGE3） RNA × 1 Template DNA × 1 Non-template DNA × 1 RPB5 homolog × 1 （Q7JZF5） ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB2_DROME
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1164； UniProt 13–1176

DNA-directed RNA polymerase II subunit RPB3

OrganismNot specified

UniProt O97183

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04052） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08266） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （Q24320） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q9VNZ3） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36958） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （Q9VC49） DNA-directed RNA polymerase II subunit RPB11 × 1 （Q9VJE4） DNA-directed RNA polymerase II subunit RPB12 × 1 （Q6IGE3） RNA × 1 Template DNA × 1 Non-template DNA × 1 RPB5 homolog × 1 （Q7JZF5） ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O97183_DROME
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–269； UniProt 2–270

DNA-directed RNA polymerases I, II, and III subunit RPABC2

OrganismNot specified

UniProt Q24320

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04052） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08266） DNA-directed RNA polymerase II subunit RPB3 × 1 （O97183） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q9VNZ3） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36958） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （Q9VC49） DNA-directed RNA polymerase II subunit RPB11 × 1 （Q9VJE4） DNA-directed RNA polymerase II subunit RPB12 × 1 （Q6IGE3） RNA × 1 Template DNA × 1 Non-template DNA × 1 RPB5 homolog × 1 （Q7JZF5） ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB2_DROME
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 1–84； UniProt 47–130

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt Q9VNZ3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04052） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08266） DNA-directed RNA polymerase II subunit RPB3 × 1 （O97183） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （Q24320） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36958） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （Q9VC49） DNA-directed RNA polymerase II subunit RPB11 × 1 （Q9VJE4） DNA-directed RNA polymerase II subunit RPB12 × 1 （Q6IGE3） RNA × 1 Template DNA × 1 Non-template DNA × 1 RPB5 homolog × 1 （Q7JZF5） ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9VNZ3_DROME
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain H； PDBConstruct 1–147； UniProt 2–148

DNA-directed RNA polymerase II subunit RPB9

OrganismNot specified

UniProt P36958

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04052） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08266） DNA-directed RNA polymerase II subunit RPB3 × 1 （O97183） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （Q24320） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q9VNZ3） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （Q9VC49） DNA-directed RNA polymerase II subunit RPB11 × 1 （Q9VJE4） DNA-directed RNA polymerase II subunit RPB12 × 1 （Q6IGE3） RNA × 1 Template DNA × 1 Non-template DNA × 1 RPB5 homolog × 1 （Q7JZF5） ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_DROME
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain I； PDBConstruct 1–116； UniProt 14–129

DNA-directed RNA polymerases I, II, and III subunit RPABC5

OrganismNot specified

UniProt Q9VC49

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04052） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08266） DNA-directed RNA polymerase II subunit RPB3 × 1 （O97183） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （Q24320） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q9VNZ3） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36958） DNA-directed RNA polymerase II subunit RPB11 × 1 （Q9VJE4） DNA-directed RNA polymerase II subunit RPB12 × 1 （Q6IGE3） RNA × 1 Template DNA × 1 Non-template DNA × 1 RPB5 homolog × 1 （Q7JZF5） ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB5_DROME
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain J； PDBConstruct 1–67； UniProt 1–67

DNA-directed RNA polymerase II subunit RPB11

OrganismNot specified

UniProt Q9VJE4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04052） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08266） DNA-directed RNA polymerase II subunit RPB3 × 1 （O97183） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （Q24320） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q9VNZ3） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36958） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （Q9VC49） DNA-directed RNA polymerase II subunit RPB12 × 1 （Q6IGE3） RNA × 1 Template DNA × 1 Non-template DNA × 1 RPB5 homolog × 1 （Q7JZF5） ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB11_DROME
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain K； PDBConstruct 1–116； UniProt 1–116

DNA-directed RNA polymerase II subunit RPB12

OrganismNot specified

UniProt Q6IGE3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04052） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08266） DNA-directed RNA polymerase II subunit RPB3 × 1 （O97183） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （Q24320） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q9VNZ3） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36958） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （Q9VC49） DNA-directed RNA polymerase II subunit RPB11 × 1 （Q9VJE4） RNA × 1 Template DNA × 1 Non-template DNA × 1 RPB5 homolog × 1 （Q7JZF5） ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6IGE3_DROME
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain L； PDBConstruct 1–46； UniProt 12–57

RPB5 homolog

OrganismNot specified

UniProt Q7JZF5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 10 DNA 2 RNA 1	DNA-directed RNA polymerase II subunit RPB1 × 1 （P04052） DNA-directed RNA polymerase II subunit RPB2 × 1 （P08266） DNA-directed RNA polymerase II subunit RPB3 × 1 （O97183） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （Q24320） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （Q9VNZ3） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36958） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （Q9VC49） DNA-directed RNA polymerase II subunit RPB11 × 1 （Q9VJE4） DNA-directed RNA polymerase II subunit RPB12 × 1 （Q6IGE3） RNA × 1 Template DNA × 1 Non-template DNA × 1 ZINC ION × 8	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7JZF5_DROME
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain E； PDBConstruct 1–210； UniProt 1–210

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9mu8
Deposition date deposition_date	2025-01-13
Structure title title	Structure of a native Drosophila melanogaster Pol II Elongation Complex without Rpb4/Rpb7 stalk
Keywords keywords	polymerase, Pol II, transcription, mRNA; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9mu8__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9mu8__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9mu8__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.86 Å
Rg (electron density)	48.95 Å
Total Rg	49.24 Å
Atom count	31485
Residues	3788
Excluded volume	554920 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9mu8__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase II subunit RPB1
Molecular weight formula_weight	166420.4 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	31485

SKAPLRQVKRVQFGILSPDEIRRMSVTEGGVQFAETMEGGRPKLGGLMDPRQGVIDRTSRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKTIKILRCVCFYCSKMLVSPHNPKIKEIVMKSRGQPRKRLAYVYDLCKGKTICEGGEDMDLTKENQQPDPNKKPGHGGCGHYQPSIRRTGLDLTAEWKHQNEDSQEKKIVVSAERVWEILKHITDEECFILGMDPKYARPDWMIVTVLPVPPLAVRPAVVMFGAAKNQDDLTHKLSDIIKANNELRKNEASGAAAHVIQENIKMLQFHVATLVDNDMPGMPRAMQKSGKPLKAIKARLKGKEGRIRGNLMGKRVDFSARTVITPDPNLRIDQVGVPRSIAQNLTFPELVTPFNIDRMQELVRRGNSQYPGAKYIVRDNGERIDLRFHPKSSDLHLQCGYKVERHLRDDDLVIFNRQPTLHKMSMMGHRVKVLPWSTFRMNLSCTSPYNADFDGDEMNLHVPQSMETRAEVENIHITPRQIITPQANKPVMGIVQDTLTAVRKMTKRDVFITREQVMNLLMFLPTWDAKMPQPCILKPRPLWTGKQIFSLIIPGNVNMIRTHSTHPDEEDEGPYKWISPGDTKVMVEHGELIMGILCKKSLGTSAGSLLHICFLELGHDIAGRFYGNIQTVINNWLLFEGHSIGIGDTIADPQTYNEIQQAIKKAKDDVINVIQKAHNMELEPTPGNTLRQTFENKVNRILNDARDKTGGSAKKSLTEYNNLKAMVVSGSKGSNINISQVIACVGQQNVEGKRIPYGFRKRTLPHFIKDDYGPESRGFVENSYLAGLTPSEFYFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSVGQLIQLRYGEDGLCGELVEFQNMPTVKLSNKSFEKRFKFDWSNERLMKKVFTDDVIKEMTDSSEAIQELEAEWDRLVSDRDSLRQIFPNGESKVVLPCNLQRMIWNVQKIFHINKRLPTDLSPIRVIKGVKTLLERCVIVTGNDRISKQANENATLLFQCLIRSTLCTKYVSEEFRLSTEAFEWLVGEIETRFQQAQANPGEMVGALAAQSLGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEIINISKKPKAPSLTVFLTGGAARDAEKAKNVLCRLEHTTLRKVTANTAIYYDPDPQRTVISEDQEFVNVYYEMPDFDPTRISPWLLRIELDRKRMTDKKLTMEQIAEKINVGFGEDLNCIFNDDNADKLVLRIRIMNNEENKFQDEDEAVDKMEDDMFLRCIEANMLSDMTLQGIEAIGKVYMHLPQTDSKKRIVITETGEFKAIGEWLLETDGTSMMKVLSERDVDPIRTSSNDICEIFQVLGIEAVRKSVEKEMNAVLQFYGLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCSFEETVDVLMDAAAHAETDPMRGVSENIIMGQLPKMGTGCFDLLLDAEKCRFGI

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase II subunit RPB2
Molecular weight formula_weight	132640.1 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

ENAEEISHELWQEACWIVINAYFDEKGLVRQQLDSFDEFIQMSVQRIVEDSPAIELQAEAQHTSGEVETPPRFSLKFEQIYLSKPTHWEKDGSPSPMMPNEARLRNLTYSAPLYVDITKTKNVEGLDPVETQHQKTFIGKIPIMLRSTYCLLSQLTDRDLTELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFSMKDGKYAFKTEIRSCLEHSSRPTSTLWVNMMARGSQNIKKSAIGQRIIAILPYIKQEIPIMIVFRALGFVADRDILEHIIYDFDDPEMMEMVKPSLDEAFVVQEQNVALNFIGARGARPGVTKDKRIKYAKEILQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLASLGRRELDDRDHYGNKRLDLAGPLLAFLFRGLFKNLMKEVRMYTQKFIDRGKDFNLELAIKTNIITDGLRYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRVNSPIGRDGKLAKPRQLHNTLWGMLCPAETPEGAAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEIAPSAIADATKIFVNGCWVGIHRDPEQLMATLRKLRRQMDIIVSEVSMIRDIRDREIRIYTDAGRICRPLLIVENGSLLLKKTHVEMLKERDYNNYSWQVLVASGVVEYIDTLEEETVMIAMSPYDLKQDKDYAYCTTYTHCEIHPAMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPMKPLVTTRSMEYLRFRELPAGINSIVAILCYTGYNQEDSVILNASAVERGFFRSVFYRSYKDSENKRVGDQEENFEKPHRGTCQGMRNAHYDKLDDDGIIAPGIRVSGDDVVIGKTITLPENDDELDSNTKRFSKRDASTFLRNSETGIVDQVMLTLNSEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMAFTCEGLAPDIIINPHAIPSRMTIGHLIECLQGKLGSNKGEIGDATPFNDAVNVQKISTFLQEYGYHLRGNEVMYNGHTGRKINAQVFLGPTYYQRLKHMVDDKIHSRARGPVQILVRQPMEGRARDGGLRFGEMERDCQISHGAAQFLRERLFEVSDPYRVHICNFCGLIAIANLRNNTFECKGCKNKTQISQVRLPYAAKLLFQELMSMNIAPRLMVT

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerase II subunit RPB3
Molecular weight formula_weight	30676.2 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

PYANQPSVQITELTDDNVKFVLEDTELSVANSLRRVFIAETPTLAIDWVQLEANSTVLSDEFLAHRIGLIPLISDDVVERLQYTRDCICLDFCPECSVEFTLDVKCSEEQTRHVTTADLKSSNAKVLPVTSRNQGEEDNEYGESNDEILIIKLRKGQELKLRAYAKKGFGKEHAKWNPTAGVCFEYDPDNSMRHTLYPKPDEWPKSEHTELEDDQYEAPYNWEAKPNKFFFNVESAGALKPENIVVMGVQVLKNKLSNLQTQLSHESQN

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC2
Molecular weight formula_weight	9736.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

GGVPKSKRITTKYMTKYERARVLGTRALQIAMCAPIMVELDGETDPLQIAMKELKQKKIPIIIRRYLPDHSYEDWSIDELIMVD

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	16946.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

AGVLFEDIFNVKDMDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPMELGDKFRLVLATTLREDGCPDSGEYNPMEHEGTRADSFEYVMYGKIYRIEGDEAHNEASRLSAYVSFGGLLMRLQGDANNLHGFEVDQHMYLLMKRLA

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerase II subunit RPB9
Molecular weight formula_weight	13786.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

GFVGIRFCQECNNMLYPKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEIDELTHIVPDVISDPTLPRTEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRWTE

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC5
Molecular weight formula_weight	7671.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLLGHVDLIEKLLNYAPLEK

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerase II subunit RPB11
Molecular weight formula_weight	13288.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNAPPTFESFLLYEGEKKIIKELDTKVTNAAIFTINKEDHTLGNMIRNQLLKDPNVLFAGYKVPHPLEHKFVIRIQTTADYSPQEAFMNAITDLLAELSLFEERFKDAIKEKKEGG

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase II subunit RPB12
Molecular weight formula_weight	5647.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

TAMTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKRLVVFDAR

Entity 10 Entity 10 polymer

Description description	RNA
Molecular weight formula_weight	3247.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	R

AAAAAAAAAA

Entity 11 Entity 11 polymer

Description description	Template DNA
Molecular weight formula_weight	15134.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T

TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCCTTTTTTTTTTTTTTTT

Entity 12 Entity 12 polymer

Description description	Non-template DNA
Molecular weight formula_weight	12170.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	N

AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Entity 13 Entity 13 polymer

Description description	RPB5 homolog
Molecular weight formula_weight	24518.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDDEAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSEKRPARSDLIVLVAHNDDPTDQMFVFFPEEPKIGIKTIKTYCTRMQEENIHRAIVVVQGGMTPSAKQSLVDMAPKYILEQFLESELLINITEHELVPEHVVMTVEEKQELLSRYKLKENMLMRIQAGDPVARYFGLKRGQVVKIIRSSETAGRYISYRLVC

Entity 14 Entity 14 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	8

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.370 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.37 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	96409

Structure of a native Drosophila melanogaster Pol II Elongation Complex without Rpb4/Rpb7 stalk

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit RPB1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RPB5 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer