9mxc

Cryo-EM Structure of Human Enterovirus D68 USA/IL/14-18952 in Complex with Fc-MFSD6(L3)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

viral protein 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 300 其他Polymer 60	viral protein 2 × 60 （A0A1B0T636） viral protein 3 × 60 （A0A097BW17） viral protein 4 × 60 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 60 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 60 SODIUM ION × 180 water × 300	Consistent with protein count
2	Other combination	Heteromer	Protein 5 其他Polymer 1	viral protein 2 × 1 （A0A1B0T636） viral protein 3 × 1 （A0A097BW17） viral protein 4 × 1 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 1 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 3 water × 5	Consistent with protein count
3	Other combination	Heteromer	Protein 25 其他Polymer 5	viral protein 2 × 5 （A0A1B0T636） viral protein 3 × 5 （A0A097BW17） viral protein 4 × 5 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 5 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 5 SODIUM ION × 15 water × 25	Consistent with protein count
4	Other combination	Heteromer	Protein 30 其他Polymer 6	viral protein 2 × 6 （A0A1B0T636） viral protein 3 × 6 （A0A097BW17） viral protein 4 × 6 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 6 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 6 SODIUM ION × 18 water × 30	Consistent with protein count
5	Other combination	Heteromer	Protein 5 其他Polymer 1	viral protein 2 × 1 （A0A1B0T636） viral protein 3 × 1 （A0A097BW17） viral protein 4 × 1 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 1 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 3 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1I9KHM1_HED68
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–297； UniProt 565–861

viral protein 2

OrganismNot specified

UniProt A0A1B0T636

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 300 其他Polymer 60	viral protein 1 × 60 （A0A1I9KHM1） viral protein 3 × 60 （A0A097BW17） viral protein 4 × 60 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 60 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 60 SODIUM ION × 180 water × 300	Consistent with protein count
2	Other combination	Heteromer	Protein 5 其他Polymer 1	viral protein 1 × 1 （A0A1I9KHM1） viral protein 3 × 1 （A0A097BW17） viral protein 4 × 1 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 1 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 3 water × 5	Consistent with protein count
3	Other combination	Heteromer	Protein 25 其他Polymer 5	viral protein 1 × 5 （A0A1I9KHM1） viral protein 3 × 5 （A0A097BW17） viral protein 4 × 5 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 5 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 5 SODIUM ION × 15 water × 25	Consistent with protein count
4	Other combination	Heteromer	Protein 30 其他Polymer 6	viral protein 1 × 6 （A0A1I9KHM1） viral protein 3 × 6 （A0A097BW17） viral protein 4 × 6 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 6 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 6 SODIUM ION × 18 water × 30	Consistent with protein count
5	Other combination	Heteromer	Protein 5 其他Polymer 1	viral protein 1 × 1 （A0A1I9KHM1） viral protein 3 × 1 （A0A097BW17） viral protein 4 × 1 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 1 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 3 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1B0T636_HED68
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–237； UniProt 81–317

viral protein 3

OrganismNot specified

UniProt A0A097BW17

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 300 其他Polymer 60	viral protein 1 × 60 （A0A1I9KHM1） viral protein 2 × 60 （A0A1B0T636） viral protein 4 × 60 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 60 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 60 SODIUM ION × 180 water × 300	Consistent with protein count
2	Other combination	Heteromer	Protein 5 其他Polymer 1	viral protein 1 × 1 （A0A1I9KHM1） viral protein 2 × 1 （A0A1B0T636） viral protein 4 × 1 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 1 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 3 water × 5	Consistent with protein count
3	Other combination	Heteromer	Protein 25 其他Polymer 5	viral protein 1 × 5 （A0A1I9KHM1） viral protein 2 × 5 （A0A1B0T636） viral protein 4 × 5 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 5 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 5 SODIUM ION × 15 water × 25	Consistent with protein count
4	Other combination	Heteromer	Protein 30 其他Polymer 6	viral protein 1 × 6 （A0A1I9KHM1） viral protein 2 × 6 （A0A1B0T636） viral protein 4 × 6 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 6 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 6 SODIUM ION × 18 water × 30	Consistent with protein count
5	Other combination	Heteromer	Protein 5 其他Polymer 1	viral protein 1 × 1 （A0A1I9KHM1） viral protein 2 × 1 （A0A1B0T636） viral protein 4 × 1 （Q68T42） Major facilitator superfamily domain-containing protein 6 × 1 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 3 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A097BW17_HED68
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–247； UniProt 318–564

viral protein 4

OrganismNot specified

UniProt Q68T42

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 300 其他Polymer 60	viral protein 1 × 60 （A0A1I9KHM1） viral protein 2 × 60 （A0A1B0T636） viral protein 3 × 60 （A0A097BW17） Major facilitator superfamily domain-containing protein 6 × 60 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 60 SODIUM ION × 180 water × 300	Consistent with protein count
2	Other combination	Heteromer	Protein 5 其他Polymer 1	viral protein 1 × 1 （A0A1I9KHM1） viral protein 2 × 1 （A0A1B0T636） viral protein 3 × 1 （A0A097BW17） Major facilitator superfamily domain-containing protein 6 × 1 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 3 water × 5	Consistent with protein count
3	Other combination	Heteromer	Protein 25 其他Polymer 5	viral protein 1 × 5 （A0A1I9KHM1） viral protein 2 × 5 （A0A1B0T636） viral protein 3 × 5 （A0A097BW17） Major facilitator superfamily domain-containing protein 6 × 5 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 5 SODIUM ION × 15 water × 25	Consistent with protein count
4	Other combination	Heteromer	Protein 30 其他Polymer 6	viral protein 1 × 6 （A0A1I9KHM1） viral protein 2 × 6 （A0A1B0T636） viral protein 3 × 6 （A0A097BW17） Major facilitator superfamily domain-containing protein 6 × 6 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 6 SODIUM ION × 18 water × 30	Consistent with protein count
5	Other combination	Heteromer	Protein 5 其他Polymer 1	viral protein 1 × 1 （A0A1I9KHM1） viral protein 2 × 1 （A0A1B0T636） viral protein 3 × 1 （A0A097BW17） Major facilitator superfamily domain-containing protein 6 × 1 （Q6ZSS7） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 3 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POLG_HED68
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–30； UniProt 29–58

Major facilitator superfamily domain-containing protein 6

Homo sapiens

UniProt Q6ZSS7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 300 其他Polymer 60	viral protein 1 × 60 （A0A1I9KHM1） viral protein 2 × 60 （A0A1B0T636） viral protein 3 × 60 （A0A097BW17） viral protein 4 × 60 （Q68T42） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 60 SODIUM ION × 180 water × 300	Consistent with protein count
2	Other combination	Heteromer	Protein 5 其他Polymer 1	viral protein 1 × 1 （A0A1I9KHM1） viral protein 2 × 1 （A0A1B0T636） viral protein 3 × 1 （A0A097BW17） viral protein 4 × 1 （Q68T42） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 3 water × 5	Consistent with protein count
3	Other combination	Heteromer	Protein 25 其他Polymer 5	viral protein 1 × 5 （A0A1I9KHM1） viral protein 2 × 5 （A0A1B0T636） viral protein 3 × 5 （A0A097BW17） viral protein 4 × 5 （Q68T42） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 5 SODIUM ION × 15 water × 25	Consistent with protein count
4	Other combination	Heteromer	Protein 30 其他Polymer 6	viral protein 1 × 6 （A0A1I9KHM1） viral protein 2 × 6 （A0A1B0T636） viral protein 3 × 6 （A0A097BW17） viral protein 4 × 6 （Q68T42） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 6 SODIUM ION × 18 water × 30	Consistent with protein count
5	Other combination	Heteromer	Protein 5 其他Polymer 1	viral protein 1 × 1 （A0A1I9KHM1） viral protein 2 × 1 （A0A1B0T636） viral protein 3 × 1 （A0A097BW17） viral protein 4 × 1 （Q68T42） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 3 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MFSD6_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–9； UniProt 200–208

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9mxc
Deposition date deposition_date	2025-01-18
Structure title title	Cryo-EM Structure of Human Enterovirus D68 USA/IL/14-18952 in Complex with Fc-MFSD6(L3)
Keywords keywords	Virus, Glycan, MFSD6, Receptor; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9mxc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9mxc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9mxc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	136.90 Å
Total Rg	137.00 Å
Atom count	768240
Residues	49200
Excluded volume	6903000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9mxc__assembly_1__model_1`	300-meric （300）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9mxc__assembly_2__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`9mxc__assembly_3__model_1`	25-meric （25）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`9mxc__assembly_4__model_1`	30-meric （30）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`9mxc__assembly_5__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	viral protein 1
Molecular weight formula_weight	32854.2 kDa
EC 编号 ec_number	3.4.22.29,3.6.1.15,3.4.22.28,2.7.7.48
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	12939

IESIIKTATDTVKSEINAELGVVPSLNAVETGATSNTEPEEAIQTRTVINQHGVSETLVENFLSRAALVSKRSFEYKDHTSSAAQTDKNFFKWTINTRSFVQLRRKLELFTYLRFDAEITILTTVAVNGSSNNTYVGLPDLTLQAMFVPTGALTPEKQDSFHWQSGSNASVFFKISDPPARMTIPFMCINSAYSVFYDGFAGFEKSGLYGINPADTIGNLCVRIVNEHQPVGFTVTVRVYMKPKHIKAWAPRPPRTLPYMSIANANYKGKGRAPNALNAIIGNRDSVKTMPHNIVTT

Entity 2 Entity 2 polymer

Description description	viral protein 2
Molecular weight formula_weight	26527.1 kDa
EC 编号 ec_number	3.4.22.29,3.6.1.15,3.4.22.28,2.7.7.48
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

RVLQLKLGNSAIVTQEAANYCCAYGEWPNYLPDHEAVAIDKPTQPETATDRFYTLRSVKWEAGSTGWWWKLPDALNNIGMFGQNVQHHYLYRSGFLIHVQCNATKFHQGALLVVAIPEHQRGAHNTNTSPGFDDIMKGEEGGTFNHPYVLDDGTSLACATIFPHQWINLRTNNSATIVLPWMNAAPMDFPLRHNQWTLAIIPVVPLGTRTMSSMVPITVSIAPMCCEFNGLRHAITQ

Entity 3 Entity 3 polymer

Description description	viral protein 3
Molecular weight formula_weight	27156.9 kDa
EC 编号 ec_number	3.4.22.29,3.6.1.15,3.4.22.28,2.7.7.48
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

GVPTYLLPGSGQFLTTDDHSSAPVLPCFNPTPEMHIPGQVRNMLEVVQVESMMEINNTESAVGMERLKVDISALTDVDQLLFNIPLDIQLDGPLRNTLVGNISRYYTHWSGSLEMTFMFCGSFMATGKLILCYTPPGGSCPTTRETAMLGTHVVWDFGLQSSVTLIIPWISGSHYRMFNNDAKSTNANVGYVTCFMQTNLIVPSESSDTCSLIGFIAAKDDFSLRLMRDSPDIGQLDHLHAAEAAYQ

Entity 4 Entity 4 polymer

Description description	viral protein 4
Molecular weight formula_weight	3401.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

QINFYKDSYAASASKQDFSQDPSKFTEPVV

Entity 5 Entity 5 polymer

Description description	Major facilitator superfamily domain-containing protein 6
Molecular weight formula_weight	1072.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

NLLETRLNV

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 branched

Description description	;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	1057.0 kDa
Source method src_method	man
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	127

▶

Resolution resolution	2.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	8656

Cryo-EM Structure of Human Enterovirus D68 USA/IL/14-18952 in Complex with Fc-MFSD6(L3)

1. Protein Identity and Related Structures Protein Identity & Related Structures

viral protein 1

State in the Current Structure

Other States of the Same Protein in the Database

viral protein 2

State in the Current Structure

Other States of the Same Protein in the Database

viral protein 3

State in the Current Structure

Other States of the Same Protein in the Database

viral protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Major facilitator superfamily domain-containing protein 6

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9mxc__assembly_1__model_1

9mxc__assembly_1__model_1 | I(q)

9mxc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 branched

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (1)

Cryo-EM Structure of Human Enterovirus D68 USA/IL/14-18952 in Complex with Fc-MFSD6(L3)

1. Protein Identity and Related Structures Protein Identity & Related Structures

viral protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

viral protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

viral protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

viral protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Major facilitator superfamily domain-containing protein 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9mxc__assembly_1__model_1

9mxc__assembly_1__model_1 | I(q)

9mxc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 branched

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (1)