SAXSdb — 9p3f

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Rv3035, BamB-like protein binding protein

Mycolicibacterium thermoresistibile

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Probable FEIII-dicitrate-binding periplasmic lipoprotein FecB × 1 （A0AB73YC50） GLYCEROL × 3 SODIUM ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A117INB7_MYCTH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–409； UniProt 17–422

Probable FEIII-dicitrate-binding periplasmic lipoprotein FecB

Mycobacterium tuberculosis

UniProt A0AB73YC50

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Rv3035, BamB-like protein binding protein × 1 （A0A117INB7） GLYCEROL × 3 SODIUM ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0AB73YC50_MYCTX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–332； UniProt 29–359

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9p3f
Deposition date deposition_date	2025-06-13
Last revision last_revision	2026-03-04
Structure title title	Structure of M. thermoresistible Rv3035 in complex with M. tuberculosis FecB
Keywords keywords	periplasmic protein, complex, lipoprotein, scaffold protein, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9p3f__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9p3f__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9p3f__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	31.52 Å
Rg (electron density)	31.33 Å
Total Rg	31.69 Å
Atom count	4731
Residues	706
Excluded volume	81395 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9p3f__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Rv3035, BamB-like protein binding protein
Molecular weight formula_weight	42661.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	4749

GHMGDAGSWVEAKPAEGWSAQYGDAANSSYTSAAGAEALTLEWSRSVKGELAAQVAVGASGYLAVNAQTPAGCSLMVWEYANSARQRWCTRLVQGGGRTSPLLDGFDNVYIGQPGAILSFPPTQWIRWRKPVIGMPTTPRILAPGELLVVTHLGQVLLFDAHRGTVTGTPLDLVAGVDPTDSERGLADCAGARRGCPVAAAPAFSAATDTVVLGLWEPGADEPVLIGFRYEPGRQLRREWTSTAVGGGPLASPVLSADGTTIYVHGRDRALWALDAADGQAKWSVPLGFQPQTPPSVSPDGLIIAGGGPGAQLVAVRDHGDRAERLWTREDAEPLSATSQTGAGVAYTVARHGDRGLALLVIDTGDGRTLNSYPLPEATGWPVGVSIAADRRVVTATSDGQVYGFAPAD

Source Source

Source organism organism	Mycolicibacterium thermoresistibile
NCBI taxonomy ID ncbi_taxonomy_id	1797
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Probable FEIII-dicitrate-binding periplasmic lipoprotein FecB
Molecular weight formula_weight	34432.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MASQSMITPTTQIAGAGVLGNDRKPDESCARAAAAADPGPPTRPAHNAAGVSPEMVQVPAEAQRIVVLSGDQLDALCALGLQSRIVAAALPNSSSSQPSYLGTTVHDLPGVGTRSAPDLRAIAAAHPDLILGSQGLTPQLYPQLAAIAPTVFTAAPGADWENNLRGVGAATARIAAVDALITGFAEHATQVGTKHDATHFQASIVQLTANTMRVYGANNFPASVLSAVGVDRPPSQRFTDKAYIEIGTTAADLAKSPDFSAADADIVYLSCASEAAAERAAVILDSDPWRKLSANRDNRVFVVNDQVWQTGEGMVAARGIVDDLRWVDAPIN

Source Source

Source organism organism	Mycobacterium tuberculosis
NCBI taxonomy ID ncbi_taxonomy_id	1773
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	18

▶

Unit-cell length a length_a	154.882 Å
Unit-cell length b length_b	154.882 Å
Unit-cell length c length_c	98.880 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	trigonal

Resolution resolution	3.350 Å
Low-resolution limit resolution_low	39.800 Å
R factor r_factor	0.2307
R_work r_work	0.2278
R_free r_free	0.2550

Structure of M. thermoresistible Rv3035 in complex with M. tuberculosis FecB

1. Protein Identity and Related Structures Protein Identity & Related Structures

Rv3035, BamB-like protein binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Probable FEIII-dicitrate-binding periplasmic lipoprotein FecB

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9p3f__assembly_1__model_1

9p3f__assembly_1__model_1 | I(q)

9p3f__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Structure of M. thermoresistible Rv3035 in complex with M. tuberculosis FecB

1. Protein Identity and Related Structures Protein Identity & Related Structures

Rv3035, BamB-like protein binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Probable FEIII-dicitrate-binding periplasmic lipoprotein FecB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9p3f__assembly_1__model_1

9p3f__assembly_1__model_1 | I(q)

9p3f__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)