← Back to search

9pxj

Cryo-EM structure of BAM from P. aeruginosa P28 in complex with Pyocin L2

Method: ELECTRON MICROSCOPY D_max: 128.9 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9pxj
deposition_date	2025-08-05
title	Cryo-EM structure of BAM from P. aeruginosa P28 in complex with Pyocin L2
keywords	;protein complex, outer membrane, beta-barrel, protein folding, Gram-negative bacterial protein, L-type bacteriocin, pyocin, MEMBRANE PROTEIN ;; MEMBRANE PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	36.10 Å
rg_electron	36.48 Å
i0	93510900.00
molecular_weight	76821.0 kDa
excluded_volume	95883 Å³
envelope_volume	136270 Å³
shell_volume	34992 Å³
envelope_diameter	136.6 Å
shell_rg	38.28 Å
envelope_rg	36.09 Å
shape_rg	36.44 Å
total_rg	36.73 Å
total_atoms	5433
n_residues	696
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	128.9 Å
rg_real	36.54 Å
rg_real_error	1.32 Å
i0_real	9.3510e+07
i0_real_error	1.5000e+06
rg_reciprocal	36.27 Å
i0_reciprocal	93490000.0000
total_estimate	0.8119
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	35.2 Å
skewness	0.627
kurtosis	-0.072
angular_range	— – 0.2200 Å⁻¹
current_alpha	0.0000
highest_alpha	6077000.0000
n_real_points	45
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.699; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.683; Smooth: 0.771

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (2)

Entity 1 polymer

description	BamA
formula_weight	88129.1 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	5433

MKRFLLPALLSALMIAEVHAESFTVSDIRVNGLQRVSAGSVFAALPLNVGETIDDQALVQATRSLFKTGFFQDIQLGRDGNVLVVTVVERPSISSIEIEGNKAISKEDLLKGLKQSGLAEGEIFQRATLEGVRNELQRQYVAQGRYSAEINAEVIPQPRNRVALKININEGTVAAISHINVVGNTVFSEEDLTDLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIASTQVSITPDKKHVYITVNINEGEKYTIRDVKLTGDLKVPEEEVKRLLLVQKGQVFSRKVMTTTSDLITRRLGNEGYTFANVNGVPEAHDDDKTVSVTFVVDPGKRAYVNRINFRGNTKTEDEVLRREMRQMEGGWASTYLIDQSKARLERLGYFKEVNVETPAVPGTDDQVDVNYSVEEQPSGSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGLTRSEYQTRYNFGFVDPYWTVDGVSLGYNAFYRKTDYDELDVDVASYSVNSLGAGMSIGYPISETSRLTYGLSVQRDQIDTGRYTVDEIYDFLDKEGDNFTNFKASIGWSESTLNKGVLATRGHSQSLTLETTLPGSDLSFYKIDYRGQVFAPLTDNYTMRFHTELGYGDGYGSTERLPFYENYYAGGFNSVRGFKDSTLGPRSTPSIARDANGKQIPGPDSQGRYTDPDQDPEAFGGNILITGGAELLFPLPFVKDQRQLRTVLFWDVGSTFDTDCPTKTTTNCDGIKTDNLASSVGVGLTWITALGPLSFSLATPIKKPDNAETQVFQFSLGQTF

Source

organism	Pseudomonas aeruginosa
ncbi_taxonomy_id	287
host_organism	Escherichia coli BL21(DE3)

Entity 2 polymer

description	Pyocin L2
formula_weight	28436.2 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	F

MASSLAPRQVIRDGQFITSPNGKYKLVMQADGNLVLYEDGTKPIWNTTPVGPGAKAVMEFNLNLYNKAGQMAWSSNVRTPYLFESFKDRAYLVLQDDGDFGIFLDQANWASLVLSEPEVGVKEKLIPTGTVMGPGTEYVNGNYRLVFQDDGNLVIYRINPLAVVWATYTMGADKAVVQEDGNFVIYKGTTALWQTRTATGVPAYLEFTDSGRLSLSQPNLQWTLKRGSLFVPPKVIPGQHGPLDTTPIWSWPHDYP

Source

organism	Pseudomonas aeruginosa 62
ncbi_taxonomy_id	1402485
host_organism	Escherichia coli BL21(DE3)

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	3.18 Å
resolution_method	—
num_particles	126889

fit	/app/data/saxs_computation/px/9pxj/9pxj.fit
pddf	/app/data/pr_computation/px/9pxj/9pxj.pr.out
profile	/app/data/saxs_computation/px/9pxj/9pxj.dat

Cryo-EM structure of BAM from P. aeruginosa P28 in complex with Pyocin L2

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

EM 3D

5. Entities & Polymer Info (2)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)