← Back to search

9qge

Crystal structure of an NADH-accepting ene reductase variant NostocER1-L1,5 mutant D352K

Method: X-RAY DIFFRACTION D_max: 98.4 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9qge
deposition_date	2025-03-13
title	Crystal structure of an NADH-accepting ene reductase variant NostocER1-L1,5 mutant D352K
keywords	Oxidoreductase, Ene reductase, Cyanobacteria, Achromobacter sp. JA81 Loop, Alkene reductase, Formate Dehydrogenase; OXIDOREDUCTASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	30.28 Å
rg_electron	29.69 Å
i0	100246000.00
molecular_weight	78696.0 kDa
excluded_volume	98158 Å³
envelope_volume	116020 Å³
shell_volume	33025 Å³
envelope_diameter	102.8 Å
shell_rg	36.24 Å
envelope_rg	29.70 Å
shape_rg	29.68 Å
total_rg	30.29 Å
total_atoms	5565
n_residues	714
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	98.4 Å
rg_real	30.38 Å
rg_real_error	0.92 Å
i0_real	1.0020e+08
i0_real_error	1.7260e+06
rg_reciprocal	30.35 Å
i0_reciprocal	100200000.0000
total_estimate	0.8759
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	96.5 Å
skewness	0.392
kurtosis	-0.565
angular_range	— – 0.2600 Å⁻¹
current_alpha	0.0000
highest_alpha	26970000.0000
n_real_points	53
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.849; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.921; Smooth: 0.917

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (6)

Entity 1 polymer

description	All1865 protein
formula_weight	40738.4 kDa
mutation	D352K
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	6661

MGHHHHHHGSGSTNINLFSSYQLGELELPNRIVMAPLTRSRAGEGNVPHQLNAIYYGQRASAGLIIAEATQVTPQGQGYPHTPGIHSPEQVAGWKLVTDTVHQQGGRIFLQLWHVGRISHPDLQPDGGLPVAPSAIAPKGEVLTYEGKKPYVTPRALDTSEIPAIVEQYRQGAANALAAGFDGVEIHAANGYLIDQFLRDGTNQRTDEYGGAIENRARLLLEVTEAITSVWDSQRVGVRLSPLTTLNGCVDSHPLETFGYVAQALNRFNLSYLHIFEAIDADIRHGGTVVPTSHLRDRFTGTLIVNGGYTREKGDTVIANKAADLVAFGTLFISNPDLPERLEVNAPLNQAKPTTFYGGGEKGYTDYPFLAVANK

Source

organism	Nostoc sp. PCC 7120 = FACHB-418
ncbi_taxonomy_id	103690
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	FLAVIN MONONUCLEOTIDE
formula_weight	456.3 kDa
src_method	syn
entity_count	2

Entity 3 non-polymer

description	1,2-ETHANEDIOL
formula_weight	62.1 kDa
src_method	syn
entity_count	2

Entity 4 non-polymer

description	CHLORIDE ION
formula_weight	35.5 kDa
src_method	syn
entity_count	2

Entity 5 non-polymer

description	SODIUM ION
formula_weight	23.0 kDa
src_method	syn
entity_count	1

Entity 6 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	882

▶

6. Citations (1)

▶

length_a	55.400 Å
length_b	68.160 Å
length_c	91.630 Å
angle_alpha	90.00 °
angle_beta	94.07 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 1 21 1
int_tables_number	4
crystal_system	—

resolution	1.433 Å
resolution_low	48.849 Å
r_factor	—
r_work	0.1508
r_free	0.1949

fit	/app/data/saxs_computation/qg/9qge/9qge.fit
pddf	/app/data/pr_computation/qg/9qge/9qge.pr.out
profile	/app/data/saxs_computation/qg/9qge/9qge.dat