← Back to search

9qih

Structure of response regulator LvrC from Leptospira

Method: X-RAY DIFFRACTION D_max: 97.7 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9qih
deposition_date	2025-03-17
last_revision	2026-03-25
title	Structure of response regulator LvrC from Leptospira
keywords	Anti-sigma factor, response regulator, Leptospirosis, gene regulation, histidine kinase, SIGNALING PROTEIN; SIGNALING PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	30.27 Å
rg_electron	29.41 Å
i0	71698900.00
molecular_weight	67644.0 kDa
excluded_volume	85128 Å³
envelope_volume	107900 Å³
shell_volume	31222 Å³
envelope_diameter	95.3 Å
shell_rg	36.30 Å
envelope_rg	28.93 Å
shape_rg	29.40 Å
total_rg	30.13 Å
total_atoms	4756
n_residues	590
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	97.7 Å
rg_real	30.32 Å
rg_real_error	0.67 Å
i0_real	7.1700e+07
i0_real_error	1.0190e+06
rg_reciprocal	30.30 Å
i0_reciprocal	71700000.0000
total_estimate	0.8930
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	28.2 Å
skewness	0.297
kurtosis	-0.683
angular_range	— – 0.2600 Å⁻¹
current_alpha	0.0000
highest_alpha	20450000.0000
n_real_points	53
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.898; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.934; Smooth: 0.978

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	SenB
formula_weight	34315.3 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	4929

LTPMRILFLDDEEMIRDLFREIFGTIHDLTLIGSAEEALEVCKDKSFDLIITDVRLPKMSGIDFISRLRDKEINTPFIVITGNQDIEISIRALRLGAVDFFIKPFRMDAIRHSLQKFESLFISSQELISKNHFQLTHSKQNFAIKPSLKNLNQYVNLVMRSISLTPGIHTDDILSIKLALYELLGNAIEHGFAGISYEHKASLLSSDVDYVDHVDKICADINECVLLEIGFEDQKVYVSLKDRGAGFDPSKVPDPVTDPNASYLSGRGIFLARMNVDELVYNDIGNEVSFSKTLKRANSKVNAS

Source

organism	Leptospira interrogans
ncbi_taxonomy_id	173
host_organism	Escherichia coli

Entity 2 non-polymer

description	4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID
formula_weight	238.3 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	ADENOSINE-5'-DIPHOSPHATE
formula_weight	427.2 kDa
src_method	syn
entity_count	2

Entity 4 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	2

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	137

▶

6. Citations (1)

▶

length_a	70.289 Å
length_b	85.210 Å
length_c	111.271 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	P 21 21 21
int_tables_number	19
crystal_system	orthorhombic

resolution	2.600 Å
resolution_low	34.010 Å
r_factor	0.2058
r_work	0.2034
r_free	0.2525

fit	/app/data/saxs_computation/qi/9qih/9qih.fit
pddf	/app/data/pr_computation/qi/9qih/9qih.pr.out
profile	/app/data/saxs_computation/qi/9qih/9qih.dat