← Back to search

9quz

Crystal structure of CtaG from Ruminiclostridium cellulolyticum (P2(1)-small)

Method: X-RAY DIFFRACTION D_max: 65.3 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9quz
deposition_date	2025-04-11
title	Crystal structure of CtaG from Ruminiclostridium cellulolyticum (P2(1)-small)
keywords	Amide Bond Formation; Antibiotics; Biosynthesis; Carrier proteins; Enzymes, Nonribosomal Peptide Synthetases, LIGASE; LIGASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	21.10 Å
rg_electron	20.00 Å
i0	22921600.00
molecular_weight	36597.0 kDa
excluded_volume	45748 Å³
envelope_volume	53390 Å³
shell_volume	22044 Å³
envelope_diameter	65.9 Å
shell_rg	26.73 Å
envelope_rg	20.20 Å
shape_rg	19.95 Å
total_rg	21.02 Å
total_atoms	2584
n_residues	308
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	65.3 Å
rg_real	20.99 Å
rg_real_error	0.31 Å
i0_real	2.2920e+07
i0_real_error	2.8260e+05
rg_reciprocal	21.01 Å
i0_reciprocal	22920000.0000
total_estimate	0.9070
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	2
r_peak_primary	25.0 Å
skewness	0.199
kurtosis	-0.486
angular_range	— – 0.3750 Å⁻¹
current_alpha	0.0000
highest_alpha	8834000.0000
n_real_points	69
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.930; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.997; Smooth: 0.999

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Butirosin biosynthesis protein H N-terminal domain-containing protein
formula_weight	37191.8 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2727

GSHMASMLLDTFQGYNCYSSALGEYAKQKNIDQVENIILSQWSFFFDEEQFYKNQWYTGAADGPVDVVLNEDLRNFANIEVLEHISSESQAIDEGRKVLEKHGLQIVLMDFYYMNSFNWKSLSRFNVTREHDPHFAVLTQINENSVHIIDPYYHHEENMSMEDFIKSRNSMTKQGKISFNSYEIFSNGTKKSNIKELLYYRFNRYLQEKMFGKITQFGQVVKKQLDNKDRKWAFTGYNCLNSVVYQHQNLINLQKKFSLEMPPNLQELLDNWALIRKKLFEYYSRGSYNTEEISNLICKVASSEEQFAQEVLKVL

Source

organism	Ruminiclostridium cellulolyticum
ncbi_taxonomy_id	1521
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	SULFATE ION
formula_weight	96.1 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	CARBONATE ION
formula_weight	60.0 kDa
src_method	syn
entity_count	1

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	143

▶

6. Citations (1)

▶

length_a	46.760 Å
length_b	60.300 Å
length_c	54.910 Å
angle_alpha	90.00 °
angle_beta	108.91 °
angle_gamma	90.00 °
z_pdb	2

space_group	P 1 21 1
int_tables_number	4
crystal_system	—

resolution	1.400 Å
resolution_low	30.000 Å
r_factor	0.1584
r_work	0.1568
r_free	0.1891

fit	/app/data/saxs_computation/qu/9quz/9quz.fit
pddf	/app/data/pr_computation/qu/9quz/9quz.pr.out
profile	/app/data/saxs_computation/qu/9quz/9quz.dat

Crystal structure of CtaG from Ruminiclostridium cellulolyticum (P2(1)-small)

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction