← Back to search

9s26

Crystal structure of human SIRT2 in complex with the covalent adduct of peptide triazole inhibitor LTDi1 and ADP-ribose

Method: X-RAY DIFFRACTION D_max: 72.0 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9s26
deposition_date	2025-07-21
title	Crystal structure of human SIRT2 in complex with the covalent adduct of peptide triazole inhibitor LTDi1 and ADP-ribose
keywords	Sirtuins, Mechanistic Inhibitor, Deacetylation, Covalent adduct, HYDROLASE; HYDROLASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	20.72 Å
rg_electron	19.88 Å
i0	37605700.00
molecular_weight	31796.0 kDa
excluded_volume	30804 Å³
envelope_volume	49684 Å³
shell_volume	21024 Å³
envelope_diameter	70.7 Å
shell_rg	26.29 Å
envelope_rg	20.12 Å
shape_rg	19.85 Å
total_rg	20.58 Å
total_atoms	2397
n_residues	295
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	72.0 Å
rg_real	20.68 Å
rg_real_error	0.49 Å
i0_real	3.7610e+07
i0_real_error	5.2430e+05
rg_reciprocal	20.69 Å
i0_reciprocal	37610000.0000
total_estimate	0.8616
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	24.0 Å
skewness	0.350
kurtosis	-0.256
angular_range	— – 0.3850 Å⁻¹
current_alpha	0.0000
highest_alpha	5808000.0000
n_real_points	70
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.738; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.984; Smooth: 0.998

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	NAD-dependent protein deacetylase sirtuin-2
formula_weight	34416.7 kDa
ec_number	3.5.1.-
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2452

GHMERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQS

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli

Entity 2 polymer

description	TNFa-derived lysine triazole dodecyl inhibitor
formula_weight	843.9 kDa
src_method	syn
entity_count	1

Polymer

type	polypeptide(L)
strand_id	C

EALPKATGG

Entity 3 non-polymer

description	ZINC ION
formula_weight	65.4 kDa
src_method	syn
entity_count	1

Entity 4 non-polymer

description	;[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{S})-5-(5-dodecyl-3-propyl-1,2,3$l^{4}-triazacyclopenta-2,4-dien-1-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate ;
formula_weight	821.8 kDa
src_method	syn
entity_count	1

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	35

▶

6. Citations (1)

▶

length_a	89.683 Å
length_b	89.683 Å
length_c	133.905 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	P 43 21 2
int_tables_number	96
crystal_system	—

resolution	2.300 Å
resolution_low	57.310 Å
r_factor	0.2181
r_work	0.2164
r_free	0.2515

fit	/app/data/saxs_computation/s2/9s26/9s26.fit
pddf	/app/data/pr_computation/s2/9s26/9s26.pr.out
profile	/app/data/saxs_computation/s2/9s26/9s26.dat

Crystal structure of human SIRT2 in complex with the covalent adduct of peptide triazole inhibitor LTDi1 and ADP-ribose

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (5)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Entity 3 non-polymer

Entity 4 non-polymer

Entity 5 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)