← Back to search

9tb7

Crystal structure of the CsPYL1(I91L-V112L-V192L)-ABA-HAB1 ternary complex

Method: X-RAY DIFFRACTION D_max: 89.4 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9tb7
deposition_date	2025-11-19
last_revision	2026-05-06
title	Crystal structure of the CsPYL1(I91L-V112L-V192L)-ABA-HAB1 ternary complex
keywords	ABA receptor, inhibitory ternary complex, PLANT PROTEIN; PLANT PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	27.00 Å
rg_electron	26.51 Å
i0	51212300.00
molecular_weight	54519.0 kDa
excluded_volume	67737 Å³
envelope_volume	82405 Å³
shell_volume	26763 Å³
envelope_diameter	92.6 Å
shell_rg	32.98 Å
envelope_rg	27.07 Å
shape_rg	26.52 Å
total_rg	27.18 Å
total_atoms	3834
n_residues	485
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	89.4 Å
rg_real	27.15 Å
rg_real_error	0.80 Å
i0_real	5.1210e+07
i0_real_error	8.2130e+05
rg_reciprocal	27.11 Å
i0_reciprocal	51210000.0000
total_estimate	0.7955
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	28.8 Å
skewness	0.489
kurtosis	-0.322
angular_range	— – 0.2950 Å⁻¹
current_alpha	0.0000
highest_alpha	8706000.0000
n_real_points	60
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.819; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.881; Smooth: 0.000

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (7)

Entity 1 polymer

description	Abscisic acid receptor PYL1
formula_weight	23322.9 kDa
mutation	I91L-V112L-V192L
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	4035

MDNNKAEADTSSSMADPETRPTYTTHHLAIPSGVTQDEFDELKQSVVEFHTYQLSQNQCSSLLAQRIRAPNDVVWSIVRRFDQPQTYKHFLKSCSVSDNFTMAVGSTRDVNLISGLPAATSTERLDILDDDRQVTGFSIIGGEHRLRNYRSVTSVHGFNRDGAICTVVLESYVVDVPEGNTEEDTRLFADTLVKLNLQKLVSVAESQVI

Source

organism	Citrus sinensis
common_name	sweet orange
ncbi_taxonomy_id	2711
host_organism	Escherichia coli

Entity 2 polymer

description	Protein phosphatase 2C 16
formula_weight	36872.3 kDa
ec_number	3.1.3.16
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

SVYELDCIPLWGVVSIQGNRSEMEDAFAVSPHFLKLPIKMLMGDHEGMSPSLTHLTGHFFGVYDGHGGHKVADYCRDRLHFALAEEIERIKDELCKRNTGEGRQVQWDKVFTSCFLTVDGEIEGKIGRAVVGSSDKVLEAVASETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQEVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDLKAQRKFKTRT

Source

organism	Arabidopsis thaliana
common_name	thale cress
ncbi_taxonomy_id	3702
host_organism	Escherichia coli

Entity 3 non-polymer

description	(2Z,4E)-5-[(1S)-1-hydroxy-2,6,6-trimethyl-4-oxocyclohex-2-en-1-yl]-3-methylpenta-2,4-dienoic acid
formula_weight	264.3 kDa
src_method	syn
entity_count	1

Entity 4 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	syn
entity_count	1

Entity 5 non-polymer

description	MANGANESE (II) ION
formula_weight	54.9 kDa
src_method	syn
entity_count	3

Entity 6 non-polymer

description	CHLORIDE ION
formula_weight	35.5 kDa
src_method	syn
entity_count	5

Entity 7 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	201

▶

6. Citations (1)

▶

length_a	43.303 Å
length_b	63.053 Å
length_c	187.301 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 21 21 21
int_tables_number	19
crystal_system	orthorhombic

resolution	1.980 Å
resolution_low	93.650 Å
r_factor	0.1927
r_work	0.1897
r_free	0.2504

fit	/app/data/saxs_computation/tb/9tb7/9tb7.fit
pddf	/app/data/pr_computation/tb/9tb7/9tb7.pr.out
profile	/app/data/saxs_computation/tb/9tb7/9tb7.dat

Crystal structure of the CsPYL1(I91L-V112L-V192L)-ABA-HAB1 ternary complex

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (7)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 non-polymer

Entity 4 non-polymer

Entity 5 non-polymer

Entity 6 non-polymer

Entity 7 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)