← Back to search

9uiu

Crystal structure of alpha-parvin CH1 dimer

Method: X-RAY DIFFRACTION D_max: 119.0 Å Quality: REASONABLE

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9uiu
deposition_date	2025-04-16
last_revision	2026-04-22
title	Crystal structure of alpha-parvin CH1 dimer
keywords	Sensor, PROTEIN BINDING; PROTEIN BINDING
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	31.15 Å
rg_electron	32.19 Å
i0	17426200.00
molecular_weight	33471.0 kDa
excluded_volume	42717 Å³
envelope_volume	68449 Å³
shell_volume	20899 Å³
envelope_diameter	123.5 Å
shell_rg	32.73 Å
envelope_rg	32.44 Å
shape_rg	32.17 Å
total_rg	32.31 Å
total_atoms	2360
n_residues	297
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	119.0 Å
rg_real	31.73 Å
rg_real_error	1.71 Å
i0_real	1.7430e+07
i0_real_error	3.0440e+05
rg_reciprocal	31.48 Å
i0_reciprocal	17420000.0000
total_estimate	0.7338
solution_quality	REASONABLE a REASONABLE solution
n_peaks	2
r_peak_primary	28.0 Å
skewness	0.680
kurtosis	-0.006
angular_range	— – 0.2550 Å⁻¹
current_alpha	0.0000
highest_alpha	1348000.0000
n_real_points	52
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.521; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.238; Smooth: 0.736

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Alpha-parvin
formula_weight	18079.8 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	2418

GPGSEFSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEALSG

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	FORMIC ACID
formula_weight	46.0 kDa
src_method	syn
entity_count	4

Entity 3 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	syn
entity_count	1

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	37

▶

6. Citations (1)

▶

length_a	78.832 Å
length_b	78.832 Å
length_c	135.904 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	16

space_group	P 41 21 2
int_tables_number	92
crystal_system	—

resolution	2.355 Å
resolution_low	25.735 Å
r_factor	0.2239
r_work	0.2220
r_free	0.2599

fit	/app/data/saxs_computation/ui/9uiu/9uiu.fit
pddf	/app/data/pr_computation/ui/9uiu/9uiu.pr.out
profile	/app/data/saxs_computation/ui/9uiu/9uiu.dat

Crystal structure of alpha-parvin CH1 dimer

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction