← Back to search

9uju

;The structure of Egalitarian in complex with the K10 mRNA localization signal reveals a modular binding surface required for function ;

Method: X-RAY DIFFRACTION D_max: 97.8 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9uju
deposition_date	2025-04-17
last_revision	2026-04-29
title	;The structure of Egalitarian in complex with the K10 mRNA localization signal reveals a modular binding surface required for function ;
keywords	RNA, localization, Drosophila, Egalitarian, CRISPR, RNA BINDING PROTEIN; RNA BINDING PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	31.53 Å
rg_electron	31.17 Å
i0	178400000.00
molecular_weight	84599.0 kDa
excluded_volume	96393 Å³
envelope_volume	138950 Å³
shell_volume	38180 Å³
envelope_diameter	104.8 Å
shell_rg	37.03 Å
envelope_rg	30.78 Å
shape_rg	31.12 Å
total_rg	31.71 Å
total_atoms	5811
n_residues	632
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	97.8 Å
rg_real	31.42 Å
rg_real_error	0.89 Å
i0_real	1.7840e+08
i0_real_error	2.7780e+06
rg_reciprocal	31.47 Å
i0_reciprocal	178400000.0000
total_estimate	0.9124
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	2
r_peak_primary	39.1 Å
skewness	0.164
kurtosis	-0.560
angular_range	— – 0.2500 Å⁻¹
current_alpha	0.0000
highest_alpha	11700000.0000
n_real_points	51
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.966; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.961

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	RNA (46-MER)
formula_weight	15232.0 kDa
src_method	man
entity_count	2

Polymer

type	polyribonucleotide
strand_id	B,D
atom_count	5828

GGCUUGAUUGUAUUUUUAAAUUUAUUCUUAAAAACUACAAAUUAAGCC

Source

organism	Drosophila melanogaster
ncbi_taxonomy_id	7227
host_organism	Escherichia coli

Entity 2 polymer

description	Egalitarian, isoform B
formula_weight	35253.8 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	C,A

PSHSYFVGDTWKIKVLQNTTVIANVKQSVFVTDIILKYAAKNESIVVSLDCEGINLGLKGEITLIEIGTTRGEAFLFDVQSCPAMVTDGGLKTVLEHDQVIKVIHDCRNDAANLYLQFGILLRNVFDTQAAHAILQYQESGKQVYKAKYISLNSLCEQYNAPCNPIKDQLKQIYRRDQKFWAKRPLTREMMLYAAGDVLVLIHDQLFGNLARQIKPENRALFSELCTEQILMQIKPNEVKIRKKQRKVSTEVSDLKQKLAQTSKSINLSNREIRLLRYMDLTEDEKERLKGYYKVAKKLEKMESAGNP

Source

organism	Drosophila melanogaster
common_name	fruit fly
ncbi_taxonomy_id	7227
host_organism	Escherichia coli

Entity 3 polymer

description	ALA-LEU-GLU-PHE-ALA
formula_weight	549.6 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	X

ALEFA

Source

organism	Drosophila melanogaster
ncbi_taxonomy_id	7227
host_organism	Escherichia coli

Entity 4 non-polymer

description	CALCIUM ION
formula_weight	40.1 kDa
src_method	syn
entity_count	8

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	17

▶

6. Citations (1)

▶

length_a	68.504 Å
length_b	106.799 Å
length_c	139.817 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	P 21 21 21
int_tables_number	19
crystal_system	orthorhombic

resolution	3.080 Å
resolution_low	44.480 Å
r_factor	0.2425
r_work	0.2402
r_free	0.2916

fit	/app/data/saxs_computation/uj/9uju/9uju.fit
pddf	/app/data/pr_computation/uj/9uju/9uju.pr.out
profile	/app/data/saxs_computation/uj/9uju/9uju.dat

;The structure of Egalitarian in complex with the K10 mRNA localization signal reveals a modular binding surface required for function ;

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (5)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 polymer

Polymer

Source

Entity 4 non-polymer

Entity 5 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)