← Back to search

9ve5

The MIDN Catch-IRF4 (V2Y) fusion protein

Method: X-RAY DIFFRACTION D_max: 50.2 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9ve5
deposition_date	2025-06-09
last_revision	2026-02-04
title	The MIDN Catch-IRF4 (V2Y) fusion protein
keywords	Midnolin, IRF4, proteasome, NUCLEAR PROTEIN; NUCLEAR PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	15.74 Å
rg_electron	14.29 Å
i0	4079100.00
molecular_weight	13983.0 kDa
excluded_volume	17357 Å³
envelope_volume	20234 Å³
shell_volume	12225 Å³
envelope_diameter	49.7 Å
shell_rg	19.87 Å
envelope_rg	14.46 Å
shape_rg	14.30 Å
total_rg	15.40 Å
total_atoms	981
n_residues	130
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	50.2 Å
rg_real	15.64 Å
rg_real_error	0.24 Å
i0_real	4.0790e+06
i0_real_error	4.5210e+04
rg_reciprocal	15.65 Å
i0_reciprocal	4079000.0000
total_estimate	0.8898
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	49.5 Å
skewness	0.123
kurtosis	-0.361
angular_range	— – 0.5000 Å⁻¹
current_alpha	0.0000
highest_alpha	469300.0000
n_real_points	80
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.873; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.996; Smooth: 0.949

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (2)

Entity 1 polymer

description	Midnolin,Interferon regulatory factor 4
formula_weight	7513.5 kDa
mutation	V216Y
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	981

SRPEQSVMQALESLTETQVSDFLSGRSPLTLALRVGDHMMFVQLQLAWPACENGCQYTGTFYACAPPE

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli (strain B / BL21-DE3)

Entity 2 polymer

description	Midnolin
formula_weight	7722.7 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

PGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLAQLRCHAGSG

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli (strain B / BL21-DE3)

▶

6. Citations (1)

▶

length_a	88.267 Å
length_b	88.267 Å
length_c	72.338 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	120.00 °
z_pdb	12

space_group	P 65 2 2
int_tables_number	179
crystal_system	hexagonal

resolution	3.200 Å
resolution_low	44.130 Å
r_factor	0.2181
r_work	0.2149
r_free	0.2758

fit	/app/data/saxs_computation/ve/9ve5/9ve5.fit
pddf	/app/data/pr_computation/ve/9ve5/9ve5.pr.out
profile	/app/data/saxs_computation/ve/9ve5/9ve5.dat

The MIDN Catch-IRF4 (V2Y) fusion protein

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (2)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)