{
  "code": "SASDB23",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "X-Ray Solution Scattering Study of Four Escherichia coli Enzymes Involved in Stationary-Phase Metabolism.",
    "publication": {
      "title": "X-Ray Solution Scattering Study of Four Escherichia coli Enzymes Involved in Stationary-Phase Metabolism.",
      "author_list": "Dadinova LA, Shtykova EV, Konarev PV, Rodina EV, Snalina NE, Vorobyeva NN, Kurilova SA, Nazarova TI, Jeffries CM, Svergun DI",
      "journal": "PLoS One",
      "doi": "10.1371/journal.pone.0156105",
      "pmid": "27227414",
      "published_date": "2016"
    },
    "status": "released",
    "submitted_date": "2015-12-14",
    "released_date": "2016-07-01"
  },
  "pddf_data": null,
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDB23.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB23_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB23_kratky_img.png",
  "pddf_plot": null,
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB23_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDB23.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 2M",
        "resolution": null
      },
      "name": "PETRA III",
      "city": "DESY; Hamburg",
      "country": "Germany",
      "beamline_name": "EMBL P12",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "5-keto-4-deoxyuronate isomerase (KduI) from E. coli",
          "short_name": "Kdu1",
          "sequence": "MDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVG\r\nGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDT\r\nGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMG\r\nLTELAPGNLWNTMPCHTHERRMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISP\r\nSWSIHSGVGTKAYTFIWGMVGENQVFDDMDHVAVKDLR",
          "organism": "Escherichia coli",
          "uniprot_code": "Q46938",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": null,
          "molecular_type": "protein",
          "uniprot_sequence": "MDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPITKTVSVG\nGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDT\nGTPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMG\nLTELAPGNLWNTMPCHTHERRMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISP\nSWSIHSGVGTKAYTFIWGMVGENQVFDDMDHVAVKDLR",
          "mw": 31.076,
          "total_mw": null,
          "number_molecules": null,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50 mM Tris 10 mM NaCl",
        "concentration_unit": "mM",
        "comment": null,
        "additive": "10 mM NaCl",
        "concentration": 50.0,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "5-keto-4-deoxyuronate isomerase (KduI) from E. coli",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "MSU",
            "address": "Moscow, Russia",
            "full_name": "Lomonosov Moscow State University",
            "webpage": "http://www.msu.ru"
          }
        ],
        "contributor_name": "Liubov",
        "contributor_surname": "Dadinova",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": "mg/ml",
    "date": "2013-06-20",
    "storage_temperature": 10.0,
    "cell_temperature": 10.0,
    "exposure_time": 0.05,
    "number_of_frames": 20,
    "wavelength": 0.12,
    "sample_detector_distance": 3.1,
    "concentration_min": 1.4,
    "concentration_max": 10.8,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.106,
    "s_max": 4.02,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/1kdu_img.png",
          "software": "OLIGOMER",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "mix",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDB23_fit1_model1.pdb",
          "model_mw": 63.99,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "",
          "comment": "",
          "user": 94
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/Kdu_full_O65k7z7_img.png",
          "software": "OLIGOMER",
          "pdb_link": [
            {
              "pdb_code": "1xru",
              "ext_code": "1XRU",
              "ext_type": "pdb",
              "difference_with_model": "identical"
            }
          ],
          "model_title": null,
          "type_of_model": "mix",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDB23_fit1_model2.pdb",
          "model_mw": 192.0,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "",
          "comment": "",
          "user": 94
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/2kdu_full_2qx2r5q_img.png",
          "software": "OLIGOMER",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "mix",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDB23_fit1_model3.pdb",
          "model_mw": 384.0,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "",
          "comment": "",
          "user": 94
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/KduI_extended_2_hiGoFFL_img.png",
          "software": "OLIGOMER",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "mix",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDB23_fit1_model4.pdb",
          "model_mw": 384.0,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "",
          "comment": "",
          "user": 94
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDB23_fit1_fit_img.png",
      "software": null,
      "chi_square_value": 1.77,
      "p_value": 0.0,
      "fit_residual_plot": "SASDB23_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDB23_fit1.fit",
      "fit_log": null,
      "software_version": null,
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": null,
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": "KduI exists of a mixture of species in solution that include dimers, hexamers and dodecamers. The modelling results from OLIGOMER are displayed where, in terms of volume fraction, the KduI sample consists of approximately:  30% dimers, 30% hexamers; 15% stacked dodecamers and 25% extended dodecamers. The OLIGOMER results are included in the zip archive for this entry. In addition, the Guinier plot at low-s2 is non linear. Two regions in the plot can be identified: s2, 0.01–0.035 and 0.04–0.11 nm-2, from which two values of Rg can be approximated (6.2 nm and 4.5 nm).",
  "experiment_description": "Synchrotron SAXS data from solutions of 5-keto-4-deoxyuronate isomerase (KduI) from E. coli in 50 mM Tris, pH 7.5 were collected on the P12 beam line of Petra-III (Hamburg, Germany) using a Pilatus 2M detector (I(s) vs s; s = 4π sin θ/λ, where 2θ is the scattering angle and λ=0.124 nm). Different solute concentrations in the range 2.7-11.80 mg/ml were measured using an exposure time of 1 s (recorded as 20 x 0.050 s frames). The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering from the matched solvent-blank was subtracted. The data presented here are from a single concentration scattering curve (4.0 mg/ml).",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 183.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": null,
  "pddf_i0_error": null,
  "guinier_i0": 9573.0,
  "guinier_i0_error": 25.0,
  "pddf_rg": null,
  "pddf_rg_error": null,
  "guinier_rg": 4.54,
  "guinier_rg_error": 0.01,
  "pddf_dmax": null,
  "pddf_dmax_error": null,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 37,
  "guinier_point_last": 87,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDB23_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2023-06-21T07:56:39.492710+02:00",
  "bragg_peak": []
}