{
  "code": "SASDB25",
  "status": "Published",
  "type_of_curve": "Extrapolated to infinite dilution",
  "angular_unit": "1/nm",
  "project": {
    "title": "Clinically Linked Mutations in the Central Domains of Cardiac Myosin-Binding Protein C with Distinct Phenotypes Show Differential Structural Effects.",
    "publication": {
      "title": "Clinically Linked Mutations in the Central Domains of Cardiac Myosin-Binding Protein C with Distinct Phenotypes Show Differential Structural Effects.",
      "author_list": "Nadvi NA, Michie KA, Kwan AH, Guss JM, Trewhella J",
      "journal": "Structure",
      "doi": "10.1016/j.str.2015.11.001",
      "pmid": "26688216",
      "published_date": "2016 Jan 5"
    },
    "status": "released",
    "submitted_date": "2016-06-25",
    "released_date": "2017-12-12"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDB25.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDB25.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB25_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB25_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDB25_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB25_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDB25.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "Australian  Synchrotron",
      "city": "Melbourne",
      "country": "Australia",
      "beamline_name": "SAXS/WAXS",
      "beam_geometry": "Point",
      "type_of_source": "X-ray synchrotron",
      "point_source": true,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Cardiac myosin binding protein-C: domains C5-C6-C7",
          "short_name": "cMyBP-C",
          "sequence": "GPGSRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTV",
          "organism": "Homo sapiens",
          "uniprot_code": "Q14896",
          "uniprot_range_first": 641,
          "uniprot_range_last": 964,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATE\nGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEA\nPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAG\nASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCE\nVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLK\nKRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEK\nKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRT\nLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEE\nGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIV\nQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHK\nLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIV\nVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCE\nTEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKI\nSNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGV\nVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGG\nLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE\nPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVS\nIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGL\nNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVF\nSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML\nCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG\nEARCECRLEVRVPQ",
          "mw": 35.751,
          "total_mw": 35.751,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "25 mM Tris-HCl, 250 mM NaCl, 2 mM TCEP, 0.02% sodium azide",
        "concentration_unit": "mM",
        "comment": null,
        "additive": "250 mM NaCl, 2 mM TCEP, 0.02% sodium azide",
        "concentration": 25.0,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Cardiac myosin binding protein-C: domains C5-C6-C7",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Sydney, New South Wales 2006, Australia",
            "full_name": "School of Molecular Bioscience, University of Sydney.",
            "webpage": ""
          }
        ],
        "contributor_name": "Jill",
        "contributor_surname": "Trewhella",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": "mg/ml",
    "date": "2015-04-18",
    "storage_temperature": 22.0,
    "cell_temperature": 22.0,
    "exposure_time": 1.0,
    "number_of_frames": 44,
    "wavelength": null,
    "sample_detector_distance": 1.6,
    "concentration_min": 0.7,
    "concentration_max": 3.4,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.057,
    "s_max": 3.436,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "X-ray synchrotron radiation scattering data from solutions of human cardiac myosin binding protein-C, domains C5-C6-C7 in 25 mM TrisHCl 250 mM NaCl, 2 mM TCEP, 0.02% sodium azide were collected on the SAXS/WAXS beam line of the Australian Synchrotron (Melbourne, Australia) using a Pilatus 1M-W pixel detector (I(s) vs s; s = 4π sin θ/λ, where 2θ is the scattering angle and λ=0.10332 nm). Different solute concentrations in the range 0.70-3.40 mg/ml were measured using a total exposure time of 44 s (recorded as 44 x 1 s frames). The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering from the matched solvent-blank was subtracted. The data presented here represent the SAXS profile extrapolated to zero concentration calculated from the solute concentration series.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 38.2,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.1068,
  "pddf_i0_error": null,
  "guinier_i0": 0.1055,
  "guinier_i0_error": 0.0001,
  "pddf_rg": 3.931,
  "pddf_rg_error": 0.001,
  "guinier_rg": 3.75,
  "guinier_rg_error": 0.01,
  "pddf_dmax": 14.1,
  "pddf_dmax_error": null,
  "porod_volume": 54.7,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 15,
  "guinier_point_last": 75,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDB25_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}