{
  "code": "SASDG47",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/nm",
  "project": {
    "title": "Insights into herpesvirus assembly from the structure of the pUL7:pUL51 complex.",
    "publication": {
      "title": "Insights into herpesvirus assembly from the structure of the pUL7:pUL51 complex.",
      "author_list": "Butt BG, Owen DJ, Jeffries CM, Ivanova L, Hill CH, Houghton JW, Ahmed MF, Antrobus R, Svergun DI, Welch JJ, Crump CM, Graham SC",
      "journal": "Elife",
      "doi": "10.7554/eLife.53789",
      "pmid": "32391791",
      "published_date": "2020 May 11"
    },
    "status": "released",
    "submitted_date": "2019-10-17",
    "released_date": "2020-05-20"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDG47.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDG47.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG47_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG47_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDG47_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG47_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDG47.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 6M",
        "resolution": null
      },
      "name": "PETRA III",
      "city": "DESY; Hamburg",
      "country": "Germany",
      "beamline_name": "EMBL P12",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Tegument protein UL7",
          "short_name": "pUL7",
          "sequence": "MAAATADDEGSAATILKQAIAGDRSLVEAAEAISQQTLLRLACEVRQVGDRQPRFTATSIARVDVAPGCRLRFVLDGSPEDAYVTSEDYFKRCCGQSSYRGFAVAVLTANEDHVHSLAVPPLVLLHRFSLFNPRDLLDFELACLLMYLENCPRSHATPSTFAKVLAWLGVAGRRTSPFERVRCLFLRSCHWVLNTLMFMVHVKPFDDEFVLPHWYMARYLLANNPPPVLSALFCATPTSSSFRLPGPPPRSDCVAYNPAGIMGSCWASEEVRAPLVYWWLSETPKRQTSSLFYQFCGSLEVLFQ",
          "organism": "Human alphaherpesvirus 1 strain KOS",
          "uniprot_code": "A0A110B4Q7",
          "uniprot_range_first": 1,
          "uniprot_range_last": 296,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MAAATADDEGSAATILKQAIAGDRSLVEAAEAISQQTLLRLACEVRQVGDRQPRFTATSI\nARVDVAPGCRLRFVLDGSPEDAYVTSEDYFKRCCGQSSYRGFAVAVLTANEDHVHSLAVP\nPLVLLHRFSLFNPRDLLDFELACLLMYLENCPRSHATPSTFAKVLAWLGVAGRRTSPFER\nVRCLFLRSCHWVLNTLMFMVHVKPFDDEFVLPHWYMARYLLANNPPPVLSALFCATPTSS\nSFRLPGPPPRSDCVAYNPAGIMGSCWASEEVRAPLVYWWLSETPKRQTSSLFYQFC",
          "mw": 33.907,
          "total_mw": 67.814,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        },
        {
          "long_name": "Tegument protein UL51",
          "short_name": "pUL51",
          "sequence": "MASLLGAISGWGARPEEQYEMIRAAVPPSEAEPRLQEALVVVNALLPAPITLDDALGSLDDTRRLVKARALARTYHACMVNLERLARHHPGLEAPTIDGAVAAHQDKMRRLADTCMATILQMYMSVGAADKSADVLVSQAIRSMAESDVVMEDVAIAERALGLSAFGVAGGTRSGGLGVTEAPSLGHPHTPPPEVTLAPAARNGDALPDPKPESCPRVSVPRPTASPTAPRPGPSRAAPCVLGQ",
          "organism": "Human alphaherpesvirus 1 strain KOS",
          "uniprot_code": "D3YPL0",
          "uniprot_range_first": 1,
          "uniprot_range_last": 244,
          "oligomerization": "tetramer",
          "molecular_type": "protein",
          "uniprot_sequence": "MASLLGAICGWGARPEEQYEMIRAAVPPSEAEPRLQEALVVVNALLPAPITLDDALGSLD\nDTRRLVKARALARTYHACMVNLERLARHHPGLEAPTIDGAVAAHQDKMRRLADTCMATIL\nQMYMSVGAADKSADVLVSQAIRSMAESDVVMEDVAIAERALGLSAFGVAGGTRSGGLGVT\nEAPSLGHPHTPPPEVTLAPAARNGDALPDPKPESCPRVSVPRPTASPTAPRPGPSRAAPC\nVLGQ",
          "mw": 25.448,
          "total_mw": 101.792,
          "number_molecules": 4,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM HEPES, 200 mM NaCl, 3% (v/v) glycerol, 1 mM DTT",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "2:4 heterohexamer of pUL7 and pUL51 from herpes simplex virus 1",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "University of Cambridge",
            "webpage": null
          }
        ],
        "contributor_name": "Benjamin",
        "contributor_surname": "Butt",
        "orcid": "https://orcid.org/0000-0001-6718-0470"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2019-05-16",
    "storage_temperature": null,
    "cell_temperature": 20.2,
    "exposure_time": 0.995,
    "number_of_frames": 48,
    "wavelength": 0.124,
    "sample_detector_distance": 3.0,
    "concentration_min": null,
    "concentration_max": 8.0,
    "sample_volume": 90.0,
    "flow_rate": 0.5,
    "s_min": 0.022,
    "s_max": 7.318,
    "total_exposure_time": null,
    "seccolumn": 1
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDG47_fit1_model1_img.png",
          "software": "DAMMIN",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": "SUPCOMB 23 (r10552)",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDG47_fit1_model1.pdb",
          "model_mw": 207.31,
          "bead_radius": 3.75,
          "log": null,
          "symmetry": "P2",
          "comment": "Refined DAMMIN model of the HSV-1 pUL7:pUL51 2:4 heterohexamer",
          "user": 502
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDG47_fit1_fixed_fit_img.png",
      "software": "DAMMIN",
      "chi_square_value": 0.91,
      "p_value": 0.805657,
      "fit_residual_plot": "SASDG47_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDG47_fit1.fir",
      "fit_log": null,
      "software_version": "5.3",
      "description": "Fit of the refined DAMMIN model to the HSV-1 pUL7:pUL51 2:4 heterohexamer SAXS profile"
    },
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDG47_fit2_model1_img.png",
          "software": "GASBOR",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": "2.3i",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDG47_fit2_model1.pdb",
          "model_mw": null,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "P2",
          "comment": "Representative GASBOR model of the HSV-1 pUL7:pUL51 2:4 heterohexamer",
          "user": 502
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDG47_fit2_fixed_fit_img.png",
      "software": "GASBOR",
      "chi_square_value": 1.0,
      "p_value": 0.363345,
      "fit_residual_plot": "SASDG47_fit2_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDG47_fit2.fir",
      "fit_log": null,
      "software_version": "2.3i",
      "description": "Fit of the representative GASBOR model to the HSV-1 pUL7:pUL51 2:4 heterohexamer SAXS profile"
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "The quoted experimental molecular mass, that corresponds to a 2:4 pUL7:pUL51 heterohexamer, was determined from SEC-MALLS-RI measurements performed in parallel to the SEC-SAXS. The SEC-SAXS data, Rg correlations through the dimer elution peak as well as the the SEC-MALLS-RI data are made available in the full-entry zip archive. The GASBORMX model displayed in this entry represents a 100 % volume fraction of the heterohexamer in solution that has been separated from a 1:2 pUL7:pUL51 heterotrimer (refer to SASBDB entry SASDG57).",
  "experiment_description": "Synchrotron SAXS data from the 2:4 heterohexamer of pUL7 and pUL51 from herpes simplex virus 1 in 20 mM HEPES, 200 mM NaCl, 3% (v/v) glycerol, 1 mM DTT, pH 7.5 were collected on the EMBL P12 beam line at PETRA III (Hamburg, Germany) using a Pilatus 6M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 90.00 μl sample at 8 mg/ml was injected at a 0.50 ml/min flow rate onto a GE Superdex 200 Increase 10/300 column at 20.2°C. 48 successive 0.995 second frames were collected through the minor SEC-elution peak (corresponding to the heterohexamer) and processed using CHROMIXS. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 168.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 103.9,
  "porod_mw_error": null,
  "pddf_i0": 3136.0,
  "pddf_i0_error": null,
  "guinier_i0": 3100.16,
  "guinier_i0_error": 7.09,
  "pddf_rg": 4.788,
  "pddf_rg_error": null,
  "guinier_rg": 4.56,
  "guinier_rg_error": 0.28,
  "pddf_dmax": 19.7,
  "pddf_dmax_error": null,
  "porod_volume": 340.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 21,
  "guinier_point_last": 95,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDG47_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2023-06-21T07:55:24.740692+02:00",
  "bragg_peak": []
}