{ "code": "SASDE58", "status": "Published", "type_of_curve": "SEC-SAS", "angular_unit": "1/A", "project": { "title": "A dual role in regulation and toxicity for the disordered N-terminus of the toxin GraT.", "publication": { "title": "A dual role in regulation and toxicity for the disordered N-terminus of the toxin GraT.", "author_list": "Talavera A, Tamman H, Ainelo A, Konijnenberg A, Hadži S, Sobott F, Garcia-Pino A, Hõrak R, Loris R", "journal": "Nat Commun", "doi": "10.1038/s41467-019-08865-z", "pmid": "30814507", "published_date": "2019 Feb 27" }, "status": "released", "submitted_date": "2018-11-15", "released_date": "2019-03-04" }, "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDE58.out", "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDE58.dat", "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE58_dat_img.png", "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE58_kratky_img.png", "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDE58_pofr_img.png", "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE58_guinier_img.png", "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE58.sascif", "experiment": { "instrument": { "detector": { "type": null, "name": "Pilatus 2M", "resolution": null }, "name": "Diamond Light Source", "city": "Didcot", "country": "UK", "beamline_name": "B21", "beam_geometry": "1 x 5 mm", "type_of_source": "X-ray synchrotron", "point_source": null, "line_collimation": null, "sample_path_length": null, "line_collimation_slitlength": null, "line_collimation_integrationwidth": null, "xray_energy": null, "beam_profile_ah": null, "beam_profile_al": null }, "sample": { "molecule": [ { "long_name": "Putative killer protein, Toxin GraT.", "short_name": "GraT", "sequence": "MIRSFSCADTEALFTTGKTRRGSDIKSVAERKLAMLDAATELRDLRSPPGNRLESLSGNRADQHSIRVNDQWRLCFTWTEHGPVNVEIVDYENLYFQ", "organism": "Pseudomonas putida", "uniprot_code": "Q88MI5", "uniprot_range_first": 1, "uniprot_range_last": 91, "oligomerization": "monomer", "molecular_type": "protein", "uniprot_sequence": "MIRSFSCADTEALFTTGKTRRGSDIKSVAERKLAMLDAATELRDLRSPPGNRLESLSGNR\nADQHSIRVNDQWRLCFTWTEHGPVNVEIVDYH", "mw": 11.104, "total_mw": 11.104, "number_molecules": 1, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null }, { "long_name": "antitoxin GraA, antidote of toxin GraT", "short_name": "GraA", "sequence": "MLKNGMRPIHPGEILREEFQKEMGFSAAALARALGVATPTVNNILRERGGVSADMALRLSICLDTTPEFWLNLQTAFDLRTAEQQHGDEIIGSVQRLVA", "organism": "Pseudomonas putida", "uniprot_code": "Q88MI6", "uniprot_range_first": 1, "uniprot_range_last": 99, "oligomerization": "dimer", "molecular_type": "protein", "uniprot_sequence": "MLKNGMRPIHPGEILREEFQKEMGFSAAALARALGVATPTVNNILRERGGVSADMALRLS\nICLDTTPEFWLNLQTAFDLRTAEQQHGDEIIGSVQRLVA", "mw": 10.905, "total_mw": 21.81, "number_molecules": 2, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null }, { "long_name": "Putative killer protein, Toxin GraT", "short_name": "GraT.", "sequence": "MIRSFSCADTEALFTTGKTRRGSDIKSVAERKLAMLDAATELRDLRSPPGNRLESLSGNRADQHSIRVNDQWRLCFTWTEHGPVNVEIVDYENLYFQ", "organism": "Pseudomonas putida", "uniprot_code": null, "uniprot_range_first": 1, "uniprot_range_last": 91, "oligomerization": "monomer", "molecular_type": "protein", "uniprot_sequence": null, "mw": 11.104, "total_mw": 11.104, "number_molecules": 1, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null } ], "buffer": { "name": "50 mM Tris 250 mM NaCl 2 mM TCEP", "concentration_unit": null, "comment": null, "additive": null, "concentration": null, "pka": null, "ph": 8.0, "deuteration": null }, "purity_method": null, "name": "Complex of toxin GraT with antotoxin GraA", "ext_coefficient": null, "contrast": null, "specific_vol": null, "dry_vol": null, "absorbption": null, "deuteration": null, "mixture": null }, "contributor": [ { "affiliation": [ { "short_name": "VUB", "address": "Pleinlaan 2 1050 Brussel ", "full_name": "Vrije Universiteit Brussel", "webpage": "http://www.vub.ac.be/" } ], "contributor_name": "Ariel", "contributor_surname": "Talavera", "orcid": null } ], "concentration_method": null, "concentration_unit": null, "date": "2018-06-29", "storage_temperature": 10.0, "cell_temperature": 10.0, "exposure_time": 0.5, "number_of_frames": 1200, "wavelength": 0.10332, "sample_detector_distance": 1.999, "concentration_min": null, "concentration_max": 10.0, "sample_volume": null, "flow_rate": null, "s_min": 0.064, "s_max": 4.483, "total_exposure_time": null, "seccolumn": null }, "fits": [], "estimated_volume_method": null, "pddf_software": "ATSAS GNOM", "pddf_software_version": "5.0", "i0_calibration_standard": null, "description": null, "experiment_description": "Synchrotron SAXS data from solutions of the complex formed between toxin GraT with antotoxin GraA in 50 mM Tris 250 mM NaCl 2 mM TCEP, pH 8 were collected using size exclusion chromatography SAXS (SEC-SAXS) on the B21 beam line at the Diamond Light Source (Oxfordshire, UK) using a Pilatus 2M detector at a sample-detector distance of 2.0 m and at a wavelength of λ = 0.10332 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). SEC-SAXS was performed at 10°C using the following parameters: Column: Shodex KW402.5-4F; Flow rate: 0.2 mL/min; Sample injection concentration: 12.5 mg/mL; Injection volume: 40 μL. 1200 successive 0.500 second frames were collected. The data measured through the SEC elution profile of the sample were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the individual subtracted data sets were scaled and averaged to generate the scattering profile displayed in this entry.", "tags": [], "intensity_unit": "arbitrary", "experimental_mw": 40.991, "experimental_mw_error": null, "guinier_i0_mw": 40.991, "guinier_i0_mw_error": null, "porod_mw": 39.0, "porod_mw_error": null, "pddf_i0": 0.04879, "pddf_i0_error": 1.4e-05, "guinier_i0": 0.04886, "guinier_i0_error": 3.1e-05, "pddf_rg": 2.34, "pddf_rg_error": null, "guinier_rg": 2.349, "guinier_rg_error": 0.05, "pddf_dmax": 7.91, "pddf_dmax_error": null, "porod_volume": 63.0, "porod_volume_error": null, "estimated_volume": null, "estimated_volume_error": null, "guinier_point_first": 17, "guinier_point_last": 108, "pddf_point_first": null, "pddf_point_last": null, "i0_calibration_standard_data": null, "intensities_log_log_plot": "SASDE58_datloglog_img.png", "symmetry": null, "last_modified": "2019-12-06T13:07:15.624532+01:00", "bragg_peak": [] }