{ "code": "SASDE68", "status": "Published", "type_of_curve": "SEC-SAS", "angular_unit": "1/A", "project": { "title": "A dual role in regulation and toxicity for the disordered N-terminus of the toxin GraT.", "publication": { "title": "A dual role in regulation and toxicity for the disordered N-terminus of the toxin GraT.", "author_list": "Talavera A, Tamman H, Ainelo A, Konijnenberg A, Hadži S, Sobott F, Garcia-Pino A, Hõrak R, Loris R", "journal": "Nat Commun", "doi": "10.1038/s41467-019-08865-z", "pmid": "30814507", "published_date": "2019 Feb 27" }, "status": "released", "submitted_date": "2018-11-15", "released_date": "2019-03-04" }, "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDE68.out", "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDE68.dat", "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE68_dat_img.png", "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE68_kratky_img.png", "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDE68_pofr_img.png", "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE68_guinier_img.png", "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE68.sascif", "experiment": { "instrument": { "detector": { "type": "CCD", "name": "AVIEX PCCD170170", "resolution": null }, "name": "SOLEIL", "city": "Saint-Aubin", "country": "France", "beamline_name": "SWING", "beam_geometry": "", "type_of_source": "X-ray synchrotron", "point_source": null, "line_collimation": null, "sample_path_length": null, "line_collimation_slitlength": null, "line_collimation_integrationwidth": null, "xray_energy": null, "beam_profile_ah": null, "beam_profile_al": null }, "sample": { "molecule": [ { "long_name": "GraTA operator region", "short_name": null, "sequence": "AAATTAACGAATAACGTTAAGCATTCAGCTCAT\r\nTTTAATTGCTTATTGCAATTCGTAAGTCGAGTA", "organism": null, "uniprot_code": null, "uniprot_range_first": null, "uniprot_range_last": null, "oligomerization": "monomer", "molecular_type": "DNA", "uniprot_sequence": null, "mw": 20.402, "total_mw": 20.402, "number_molecules": 1, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null }, { "long_name": "antitoxin GraA, antidote of toxin GraT", "short_name": "GraA", "sequence": "MLKNGMRPIHPGEILREEFQKEMGFSAAALARALGVATPTVNNILRERGGVSADMALRLSICLDTTPEFWLNLQTAFDLRTAEQQHGDEIIGSVQRLVA", "organism": "Pseudomonas putida", "uniprot_code": "Q88MI6", "uniprot_range_first": 1, "uniprot_range_last": 99, "oligomerization": "dimer", "molecular_type": "protein", "uniprot_sequence": "MLKNGMRPIHPGEILREEFQKEMGFSAAALARALGVATPTVNNILRERGGVSADMALRLS\nICLDTTPEFWLNLQTAFDLRTAEQQHGDEIIGSVQRLVA", "mw": 10.905, "total_mw": 21.81, "number_molecules": 2, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null }, { "long_name": "atitoxin GraA, antidote of GraT.", "short_name": "GraA", "sequence": "MLKNGMRPIHPGEILREEFQKEMGFSAAALARALGVATPTVNNILRERGGVSADMALRLSICLDTTPEFWLNLQTAFDLRTAEQQHGDEIIGSVQRLVAHHHHHH", "organism": "Pseudomonas putida", "uniprot_code": "Q88MI6", "uniprot_range_first": 1, "uniprot_range_last": 99, "oligomerization": "dimer", "molecular_type": "protein", "uniprot_sequence": "MLKNGMRPIHPGEILREEFQKEMGFSAAALARALGVATPTVNNILRERGGVSADMALRLS\nICLDTTPEFWLNLQTAFDLRTAEQQHGDEIIGSVQRLVA", "mw": 11.728, "total_mw": 23.456, "number_molecules": 2, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null } ], "buffer": { "name": "50 mM Tris 250 mM NaCl 2 mM TCEP", "concentration_unit": null, "comment": null, "additive": null, "concentration": null, "pka": null, "ph": 8.0, "deuteration": null }, "purity_method": null, "name": "Two dimers of antitoxin GraA in complex with the grta operator", "ext_coefficient": null, "contrast": null, "specific_vol": null, "dry_vol": null, "absorbption": null, "deuteration": null, "mixture": null }, "contributor": [ { "affiliation": [ { "short_name": "VUB", "address": "Pleinlaan 2 1050 Brussel ", "full_name": "Vrije Universiteit Brussel", "webpage": "http://www.vub.ac.be/" } ], "contributor_name": "Ariel", "contributor_surname": "Talavera", "orcid": null } ], "concentration_method": null, "concentration_unit": null, "date": "2017-12-17", "storage_temperature": 10.0, "cell_temperature": 10.0, "exposure_time": 1.5, "number_of_frames": 254, "wavelength": 0.10332, "sample_detector_distance": 1.785, "concentration_min": null, "concentration_max": 10.0, "sample_volume": null, "flow_rate": null, "s_min": 0.131, "s_max": 3.347, "total_exposure_time": null, "seccolumn": null }, "fits": [], "estimated_volume_method": null, "pddf_software": "ATSAS GNOM", "pddf_software_version": "5.0", "i0_calibration_standard": null, "description": null, "experiment_description": "Synchrotron SAXS data from solutions of antitoxin GraA in complex with the grta operator in 50 mM Tris 250 mM NaCl 2 mM TCEP, pH 8 were collected using size exclusion chromatography SAXS (SEC-SAXS) on the SWING beam line at SOLEIL (Saint-Aubin, France) using a CCD AVIEX PCCD170170 detector at a sample-detector distance of 1.8 m and at a wavelength of λ = 0.10332 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). SEC-SAXS was performed at 10°C using the following parameters: Column: Shodex KW402.5-4F; Flow rate: 0.2 mL/min; Sample injection concentration: approx. 10 mg/mL; Injection volume: 40 μL. 254 successive 1.500 second frames were collected. The SAXS data measured through the SEC elution profile of the sample were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the individual subtracted data sets were scaled and averaged to generate the scattering profile displayed in this entry.", "tags": [], "intensity_unit": "arbitrary", "experimental_mw": 67.055, "experimental_mw_error": null, "guinier_i0_mw": 67.055, "guinier_i0_mw_error": null, "porod_mw": 59.0, "porod_mw_error": null, "pddf_i0": 0.01713, "pddf_i0_error": 9.1e-06, "guinier_i0": 0.01713, "guinier_i0_error": 1e-05, "pddf_rg": 2.94, "pddf_rg_error": 0.02, "guinier_rg": 2.92, "guinier_rg_error": 0.002, "pddf_dmax": 10.25, "pddf_dmax_error": null, "porod_volume": 94.0, "porod_volume_error": null, "estimated_volume": null, "estimated_volume_error": null, "guinier_point_first": 12, "guinier_point_last": 56, "pddf_point_first": null, "pddf_point_last": null, "i0_calibration_standard_data": null, "intensities_log_log_plot": "SASDE68_datloglog_img.png", "symmetry": null, "last_modified": "2019-12-06T13:07:15.624532+01:00", "bragg_peak": [] }