{
  "code": "SASDD98",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "The molecular basis for Apolipoprotein E4 as the major risk factor for late onset Alzheimer's disease.",
    "publication": {
      "title": "The molecular basis for Apolipoprotein E4 as the major risk factor for late onset Alzheimer's disease.",
      "author_list": "Raulin AC, Kraft L, Al-Hilaly YK, Xue WF, McGeehan JE, Atack JR, Serpell L",
      "journal": "J Mol Biol",
      "doi": "10.1016/j.jmb.2019.04.019",
      "pmid": "31051176",
      "published_date": "2019 Apr 30"
    },
    "status": "released",
    "submitted_date": "2018-06-07",
    "released_date": "2019-05-09"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDD98.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDD98.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD98_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD98_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDD98_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDD98_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDD98.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 2M",
        "resolution": null
      },
      "name": "Diamond Light Source",
      "city": "Didcot",
      "country": "UK",
      "beamline_name": "B21",
      "beam_geometry": "1 x 5 mm",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Apolipoprotein E3",
          "short_name": "ApoE3",
          "sequence": "GPHMKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH",
          "organism": "Homo sapiens",
          "uniprot_code": "P02649",
          "uniprot_range_first": 19,
          "uniprot_range_last": 317,
          "oligomerization": "tetramer",
          "molecular_type": "protein",
          "uniprot_sequence": "MKVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQT\nLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQA\nRLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY\nQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMG\nSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEK\nVQAAVGTSAAPVPSDNH",
          "mw": 34.659,
          "total_mw": 138.636,
          "number_molecules": 4,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM HEPES, 300 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Apolipoprotein E3",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Brighton, UK",
            "full_name": "University of Sussex",
            "webpage": "http://www.sussex.ac.uk/"
          }
        ],
        "contributor_name": "Lucas",
        "contributor_surname": "Kraft",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2017-11-29",
    "storage_temperature": 4.0,
    "cell_temperature": 20.0,
    "exposure_time": 3.0,
    "number_of_frames": 1,
    "wavelength": 0.1,
    "sample_detector_distance": 3.9,
    "concentration_min": null,
    "concentration_max": null,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.034,
    "s_max": 3.696,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "4.6",
  "i0_calibration_standard": null,
  "description": "Concentration UNKNOWN.",
  "experiment_description": "Synchrotron SAXS data from solutions of human apolipoprotein E3 in 20 mM HEPES, 300 mM NaCl, pH 8 were collected on the B21 beam line at the Diamond Light Source (Oxfordshire, UK) using a Pilatus 2M detector at a sample-detector distance of 3.9 m and at a wavelength of λ = 0.1 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One 3 second frame was collected at a sample temperature of 20°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 129.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.2511,
  "pddf_i0_error": null,
  "guinier_i0": 0.25,
  "guinier_i0_error": 0.00034,
  "pddf_rg": 5.85,
  "pddf_rg_error": null,
  "guinier_rg": 5.681,
  "guinier_rg_error": 0.059,
  "pddf_dmax": 19.5,
  "pddf_dmax_error": null,
  "porod_volume": 410.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 10,
  "guinier_point_last": 89,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDD98_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}