{ "code": "SASDC99", "status": "Published", "type_of_curve": "Single concentration", "angular_unit": "1/A", "project": { "title": "Small-angle X-ray and neutron scattering demonstrates that cell-free expression produces properly formed disc-shaped nanolipoprotein particles.", "publication": { "title": "Small-angle X-ray and neutron scattering demonstrates that cell-free expression produces properly formed disc-shaped nanolipoprotein particles.", "author_list": "Cleveland TE 4th, He W, Evans AC, Fischer NO, Lau EY, Coleman MA, Butler P", "journal": "Protein Sci", "doi": "10.1002/pro.3365", "pmid": "29266475", "published_date": "2018 Mar" }, "status": "released", "submitted_date": "2017-11-21", "released_date": "2018-01-09" }, "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC99.out", "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC99.dat", "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC99_dat_img.png", "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC99_kratky_img.png", "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC99_pofr_img.png", "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC99_guinier_img.png", "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC99.sascif", "experiment": { "instrument": { "detector": { "type": "640x640 mm 3He posn sensitive prop counter", "name": "Ordela 2660N", "resolution": 5.08 }, "name": "NIST Center for High Resolution Neutron Scattering (CHRNS)", "city": "Gaithersburg, MD", "country": "USA", "beamline_name": "NG7", "beam_geometry": null, "type_of_source": "neutron source", "point_source": null, "line_collimation": null, "sample_path_length": null, "line_collimation_slitlength": null, "line_collimation_integrationwidth": null, "xray_energy": null, "beam_profile_ah": null, "beam_profile_al": null }, "sample": { "molecule": [ { "long_name": "Apolipoprotein A-I", "short_name": "ApoA-I", "sequence": "MHHHHHHGENLYFQGMLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTKAQSVIDKASETLTAQ", "organism": "Mus musculus", "uniprot_code": "Q00623", "uniprot_range_first": 67, "uniprot_range_last": 264, "oligomerization": "dimer", "molecular_type": "protein", "uniprot_sequence": "MKAVVLAVALVFLTGSQAWHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSS\nLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKV\nQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVD\nSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLM\nPMLETLKTQVQSVIDKASETLTAQ", "mw": 25.153, "total_mw": 50.306, "number_molecules": 2, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null }, { "long_name": "1,2-dimyristoyl-sn-glycero-3-phosphocholine", "short_name": "DMPC", "sequence": "N/A", "organism": null, "uniprot_code": null, "uniprot_range_first": null, "uniprot_range_last": null, "oligomerization": "other", "molecular_type": "other", "uniprot_sequence": null, "mw": 0.678, "total_mw": 92.0, "number_molecules": 0, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null } ], "buffer": { "name": "PBS in D2O", "concentration_unit": null, "comment": "8 g/L NaCl, 0.2 g/L KH2PO4, 1.15 g/L Na2HPO4, 0.2 g/L KCl, in D2O with no additional pH adjustment", "additive": null, "concentration": null, "pka": null, "ph": 7.4, "deuteration": null }, "purity_method": null, "name": "Nanolipoprotein Particle (NLP) from In Vitro Assembly - 100% D2O SANS", "ext_coefficient": null, "contrast": null, "specific_vol": null, "dry_vol": null, "absorbption": null, "deuteration": null, "mixture": null }, "contributor": [ { "affiliation": [ { "short_name": "NIST", "address": "Gaithersburg, MD, USA", "full_name": "National Institute of Standards and Technology (NIST)", "webpage": "https://www.nist.gov/" } ], "contributor_name": "Thomas", "contributor_surname": "Cleveland", "orcid": null } ], "concentration_method": null, "concentration_unit": null, "date": "2015-11-25", "storage_temperature": 4.0, "cell_temperature": 20.0, "exposure_time": 1800.0, "number_of_frames": 2, "wavelength": 0.6, "sample_detector_distance": 4.0, "concentration_min": null, "concentration_max": 5.21, "sample_volume": null, "flow_rate": null, "s_min": 0.039, "s_max": 5.936, "total_exposure_time": null, "seccolumn": null }, "fits": [], "estimated_volume_method": null, "pddf_software": "ATSAS GNOM", "pddf_software_version": "5.0", "i0_calibration_standard": null, "description": "Additional SANS measurement parameters. Three detector positions (in m) and count times (s) were employed: 1 m (two frames of 300 + 900 = 1200 s total count time); 4 m (two frames of 1800 + 1800 = 3600 s total count time); 13 m (two frames of 300 + 600 = 900 s total count time).", "experiment_description": "Small-angle neutron scattering (SANS) data from solutions of Nanolipoprotein Particle (NLP) from In Vitro Assembly in PBS constituted in 100% D2O, pD 7.4, were collected on the NG7 SANS instrument at the NIST Center for Neutron Research (Gaithersburg, MD, USA) using a 640x640 mm 3He position sensitive Ordela 2660N detector at wavelength of λ = 0.6 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). One solute concentration of 5.21 mg/ml was measured at 20°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.", "tags": [], "intensity_unit": "1/cm", "experimental_mw": 142.0, "experimental_mw_error": null, "guinier_i0_mw": null, "guinier_i0_mw_error": null, "porod_mw": null, "porod_mw_error": null, "pddf_i0": 2.621, "pddf_i0_error": 0.006, "guinier_i0": 2.6, "guinier_i0_error": 0.0046, "pddf_rg": 3.121, "pddf_rg_error": 0.007, "guinier_rg": 3.11, "guinier_rg_error": 0.06, "pddf_dmax": 9.09, "pddf_dmax_error": null, "porod_volume": null, "porod_volume_error": null, "estimated_volume": null, "estimated_volume_error": null, "guinier_point_first": 3, "guinier_point_last": 86, "pddf_point_first": null, "pddf_point_last": null, "i0_calibration_standard_data": null, "intensities_log_log_plot": "SASDC99_datloglog_img.png", "symmetry": null, "last_modified": "2022-08-15T15:12:53.046326+02:00", "bragg_peak": [] }