data_SASDC99_MAIN # _sas_result.id 744 _sas_result.SASBDB_code SASDC99 _sas_result.experimental_MW 142.000 _sas_result.experimental_MW_error . _sas_result.MW_standard . _sas_result.MW_standard_error . _sas_result.MW_Porod . _sas_result.MW_Porod_error . _sas_result.I0_from_PR 2.6210000000 _sas_result.I0_from_PR_error 0.0060000000 _sas_result.I0_from_Guinier 2.6000000000 _sas_result.I0_from_Guinier_error 0.0046000000 _sas_result.Rg_from_PR 3.121 _sas_result.Rg_from_PR_error 0.007 _sas_result.Rg_from_Guinier 3.110 _sas_result.Rg_from_Guinier_error 0.060 _sas_result.D_max 9.09 _sas_result.Porod_volume . _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min 3 _sas_result.Guinier_point_max 86 _sas_result.type_of_curve single_conc _sas_result.standard . _sas_result.Dmax_error . _sas_result.comments "Additional SANS measurement parameters. Three detector positions (in m) and count times (s) were employed: 1 m (two frames of 300 + 900 = 1200 s total count time); 4 m (two frames of 1800 + 1800 = 3600 s total count time); 13 m (two frames of 300 + 600 = 900 s total count time)." # _sas_scan.title "Nanolipoprotein Particle (NLP) from In Vitro Assembly - 100% D2O SANS" _sas_scan.detc_id 43 _sas_scan.id 744 _sas_scan.measurement_date 2015-11-25 _sas_scan.storage_temperature 4.0 _sas_scan.cell_temperature 20.0 _sas_scan.exposure_time 1800.000 _sas_scan.number_of_frames 2 _sas_scan.unit 1/A _sas_scan.qmin 0.0039 _sas_scan.qmax 0.5936 _sas_scan.sample_id 704 _sas_scan.result_id 744 _sas_scan.beam_id 64 # _sas_beam.id 64 _sas_beam.instrument_name "NIST Center for Neutron Research NG7" _sas_beam.instrument_city "Gaithersburg, MD" _sas_beam.instrument_country USA _sas_beam.shape . _sas_beam.type_of_source "neutron source" _sas_beam.radiation_wavelength 0.600000 _sas_beam.dist_spec_to_detc 4.00000 # _sas_detc.id 43 _sas_detc.name "Ordela 2660N" _sas_detc.type "640x640 mm 3He posn sensitive prop counter" _sas_detc.pixsize_x 5.080 # _sas_sample.id 704 _sas_sample.name "Nanolipoprotein Particle (NLP) from In Vitro Assembly - 100% D2O SANS" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration 5.21 _sas_sample.concentration_method . loop_ _sas_sample.entity_id 861 862 # _sas_buffer.id 428 _sas_buffer.name "PBS in D2O" _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.400 _sas_buffer.comment "8 g/L NaCl, 0.2 g/L KH2PO4, 1.15 g/L Na2HPO4, 0.2 g/L KCl, in D2O with no additional pH adjustment" _sas_buffer.composition . _sas_buffer.sample_id 704 # loop_ _entity.id _entity.type _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules 861 protein "Apolipoprotein A-I" 25.153 2 862 other 1,2-dimyristoyl-sn-glycero-3-phosphocholine 0.678 . # loop_ _entity_name_com.entity_id _entity_name_com.name 861 ApoA-I 862 DMPC # loop_ _entity_poly.entity_id _entity_poly.pdbx_seq_one_letter_code 861 MHHHHHHGENLYFQGMLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTKAQSVIDKASETLTAQ 862 N/A # loop_ _entity_src_gen.entity_id _entity_src_gen.gene_src_common_name 861 "Mus musculus" 862 . # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code 1 861 UniProt Q00623 2 862 UniProt . _struct_ref.details http://www.uniprot.org/uniprot/Q00623 # _citation.id 305 _citation.title "Small-angle X-ray and neutron scattering demonstrates that cell-free expression produces properly formed disc-shaped nanolipoprotein particles." _citation.year "2017 Dec 20" _citation.pdbx_database_id_DOI 10.1002/pro.3365 _citation.pdbx_database_id_PubMed 29266475 # loop_ _citation_author.citation_id _citation_author.ordinal _citation_author.name 305 1 "Cleveland TE 4th" 305 2 "He W" 305 3 "Evans AC" 305 4 "Fischer NO" 305 5 "Lau EY" 305 6 "Coleman MA" # _pdbx_contact_author.id 197 _pdbx_contact_author.name_first Thomas _pdbx_contact_author.name_last Cleveland _pdbx_contact_author.role . _pdbx_contact_author.address_1 . _pdbx_contact_author.address_2 "National Institute of Standards and Technology, Gaithersburg, MD, USA" _pdbx_contact_author.address_3 . # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 3.887000E-03 2.452810E+00 2.518000E-01 744 2 4.297000E-03 2.453810E+00 1.949000E-01 744 3 4.706000E-03 2.563810E+00 1.988000E-01 744 4 5.115000E-03 2.634810E+00 1.881000E-01 744 5 5.524000E-03 2.471810E+00 1.494000E-01 744 6 5.934000E-03 2.602810E+00 1.408000E-01 744 7 6.343000E-03 2.506810E+00 1.301000E-01 744 8 6.752000E-03 2.612810E+00 1.138000E-01 744 9 7.161000E-03 2.539810E+00 1.316000E-01 744 10 7.570000E-03 2.485810E+00 1.082000E-01 744 11 7.979000E-03 2.484810E+00 9.833000E-02 744 12 8.389000E-03 2.395810E+00 1.027000E-01 744 13 8.798000E-03 2.520810E+00 9.527000E-02 744 14 9.207000E-03 2.439810E+00 9.230000E-02 744 15 9.616000E-03 2.550810E+00 9.588000E-02 744 16 1.003000E-02 2.549810E+00 8.552000E-02 744 17 1.043000E-02 2.427810E+00 7.997000E-02 744 18 1.084000E-02 2.381810E+00 8.446000E-02 744 19 1.125000E-02 2.496810E+00 8.047000E-02 744 20 1.166000E-02 2.544810E+00 8.546000E-02 744 21 1.207000E-02 2.537810E+00 7.616000E-02 744 22 1.248000E-02 2.332810E+00 7.658000E-02 744 23 1.263000E-02 2.442810E+00 1.686000E-02 744 24 1.289000E-02 2.423810E+00 8.016000E-02 744 25 1.330000E-02 2.513810E+00 7.133000E-02 744 26 1.371000E-02 2.486810E+00 6.954000E-02 744 27 1.396000E-02 2.432810E+00 1.423000E-02 744 28 1.412000E-02 2.294810E+00 6.944000E-02 744 29 1.453000E-02 2.364810E+00 6.830000E-02 744 30 1.494000E-02 2.504810E+00 6.928000E-02 744 31 1.529000E-02 2.407810E+00 1.294000E-02 744 32 1.534000E-02 2.484810E+00 7.206000E-02 744 33 1.575000E-02 2.299810E+00 6.985000E-02 744 34 1.616000E-02 2.405810E+00 7.288000E-02 744 35 1.657000E-02 2.322810E+00 6.217000E-02 744 36 1.662000E-02 2.368810E+00 1.135000E-02 744 37 1.698000E-02 2.336810E+00 6.293000E-02 744 38 1.739000E-02 2.374810E+00 6.116000E-02 744 39 1.780000E-02 2.277810E+00 5.772000E-02 744 40 1.795000E-02 2.349810E+00 1.199000E-02 744 41 1.821000E-02 2.397810E+00 6.082000E-02 744 42 1.862000E-02 2.311810E+00 6.491000E-02 744 43 1.903000E-02 2.263810E+00 6.231000E-02 744 44 1.928000E-02 2.298810E+00 1.060000E-02 744 45 1.944000E-02 2.251810E+00 6.389000E-02 744 46 1.984000E-02 2.240810E+00 5.948000E-02 744 47 2.025000E-02 2.212810E+00 5.527000E-02 744 48 2.061000E-02 2.290810E+00 1.091000E-02 744 49 2.066000E-02 2.332810E+00 5.798000E-02 744 50 2.107000E-02 2.225810E+00 6.246000E-02 744 51 2.148000E-02 2.253810E+00 5.583000E-02 744 52 2.189000E-02 2.164810E+00 5.342000E-02 744 53 2.194000E-02 2.249810E+00 1.033000E-02 744 54 2.230000E-02 2.230810E+00 5.131000E-02 744 55 2.271000E-02 2.143810E+00 5.311000E-02 744 56 2.312000E-02 2.111810E+00 5.340000E-02 744 57 2.327000E-02 2.194810E+00 1.051000E-02 744 58 2.353000E-02 2.120810E+00 5.317000E-02 744 59 2.393000E-02 2.135810E+00 5.514000E-02 744 60 2.434000E-02 2.194810E+00 6.141000E-02 744 61 2.460000E-02 2.150810E+00 9.936000E-03 744 62 2.475000E-02 2.133810E+00 5.437000E-02 744 63 2.516000E-02 2.129810E+00 5.535000E-02 744 64 2.557000E-02 2.044810E+00 5.762000E-02 744 65 2.593000E-02 2.092810E+00 8.939000E-03 744 66 2.598000E-02 2.245810E+00 6.366000E-02 744 67 2.639000E-02 2.112810E+00 6.038000E-02 744 68 2.680000E-02 2.119810E+00 5.828000E-02 744 69 2.721000E-02 2.127810E+00 6.441000E-02 744 70 2.726000E-02 2.044810E+00 9.476000E-03 744 71 2.761000E-02 1.932810E+00 6.772000E-02 744 72 2.802000E-02 1.992810E+00 6.979000E-02 744 73 2.843000E-02 2.089810E+00 7.474000E-02 744 74 2.859000E-02 1.998810E+00 7.794000E-03 744 75 2.884000E-02 2.062810E+00 7.254000E-02 744 76 2.925000E-02 1.997810E+00 8.251000E-02 744 77 2.966000E-02 2.048810E+00 8.631000E-02 744 78 2.991000E-02 1.944810E+00 8.704000E-03 744 79 3.124000E-02 1.905810E+00 8.799000E-03 744 80 3.257000E-02 1.838810E+00 8.127000E-03 744 81 3.390000E-02 1.794810E+00 8.191000E-03 744 82 3.523000E-02 1.733810E+00 7.528000E-03 744 83 3.656000E-02 1.692810E+00 7.198000E-03 744 84 3.788000E-02 1.657810E+00 6.701000E-03 744 85 3.921000E-02 1.578810E+00 7.041000E-03 744 86 4.054000E-02 1.524810E+00 6.579000E-03 744 87 4.187000E-02 1.469810E+00 6.277000E-03 744 88 4.320000E-02 1.414810E+00 6.358000E-03 744 89 4.452000E-02 1.373810E+00 6.239000E-03 744 90 4.585000E-02 1.307810E+00 6.061000E-03 744 91 4.718000E-02 1.253810E+00 5.763000E-03 744 92 4.850000E-02 1.195810E+00 5.388000E-03 744 93 4.983000E-02 1.149810E+00 5.689000E-03 744 94 5.116000E-02 1.098810E+00 5.821000E-03 744 95 5.248000E-02 1.052810E+00 5.558000E-03 744 96 5.381000E-02 9.978100E-01 4.578000E-03 744 97 5.514000E-02 9.568100E-01 4.871000E-03 744 98 5.646000E-02 9.058100E-01 4.794000E-03 744 99 5.779000E-02 8.569100E-01 4.625000E-03 744 100 5.911000E-02 8.119100E-01 4.707000E-03 744 101 6.044000E-02 7.733100E-01 4.577000E-03 744 102 6.176000E-02 7.250100E-01 4.165000E-03 744 103 6.309000E-02 6.902100E-01 3.853000E-03 744 104 6.441000E-02 6.467100E-01 4.269000E-03 744 105 6.573000E-02 6.124100E-01 3.930000E-03 744 106 6.706000E-02 5.792100E-01 3.743000E-03 744 107 6.838000E-02 5.467100E-01 3.709000E-03 744 108 6.971000E-02 5.079100E-01 3.611000E-03 744 109 7.103000E-02 4.705100E-01 3.109000E-03 744 110 7.235000E-02 4.396100E-01 3.381000E-03 744 111 7.367000E-02 4.180100E-01 3.141000E-03 744 112 7.500000E-02 3.910100E-01 3.149000E-03 744 113 7.632000E-02 3.614100E-01 3.088000E-03 744 114 7.764000E-02 3.323100E-01 2.985000E-03 744 115 7.896000E-02 3.126100E-01 2.774000E-03 744 116 8.028000E-02 2.956100E-01 2.821000E-03 744 117 8.161000E-02 2.655100E-01 3.013000E-03 744 118 8.227000E-02 2.571100E-01 3.956000E-03 744 119 8.293000E-02 2.505100E-01 3.050000E-03 744 120 8.425000E-02 2.360100E-01 3.384000E-03 744 121 8.557000E-02 2.216100E-01 3.281000E-03 744 122 8.689000E-02 2.037100E-01 3.347000E-03 744 123 8.755000E-02 1.922100E-01 2.969000E-03 744 124 8.821000E-02 1.828100E-01 3.390000E-03 744 125 8.952000E-02 1.728100E-01 3.280000E-03 744 126 9.084000E-02 1.628100E-01 3.640000E-03 744 127 9.216000E-02 1.465100E-01 3.725000E-03 744 128 9.282000E-02 1.421100E-01 2.321000E-03 744 129 9.348000E-02 1.347100E-01 3.698000E-03 744 130 9.480000E-02 1.153100E-01 4.161000E-03 744 131 9.612000E-02 1.272100E-01 3.765000E-03 744 132 9.809000E-02 1.034100E-01 1.975000E-03 744 133 1.034000E-01 7.721000E-02 1.476000E-03 744 134 1.086000E-01 5.801000E-02 1.124000E-03 744 135 1.139000E-01 4.491000E-02 1.047000E-03 744 136 1.191000E-01 3.681000E-02 1.045000E-03 744 137 1.244000E-01 2.681000E-02 9.950000E-04 744 138 1.296000E-01 2.231000E-02 9.367000E-04 744 139 1.348000E-01 1.931000E-02 1.017000E-03 744 140 1.400000E-01 1.661000E-02 9.748000E-04 744 141 1.452000E-01 1.311000E-02 8.462000E-04 744 142 1.504000E-01 1.011000E-02 1.011000E-03 744 143 1.556000E-01 9.010000E-03 8.450000E-04 744 144 1.608000E-01 7.110000E-03 7.722000E-04 744 145 1.660000E-01 6.310000E-03 8.112000E-04 744 146 1.712000E-01 6.710000E-03 8.276000E-04 744 147 1.763000E-01 5.810000E-03 7.481000E-04 744 148 1.815000E-01 3.710000E-03 8.063000E-04 744 149 1.866000E-01 4.810000E-03 7.886000E-04 744 150 1.917000E-01 4.510000E-03 7.643000E-04 744 151 1.968000E-01 3.110000E-03 7.825000E-04 744 152 2.019000E-01 3.710000E-03 7.655000E-04 744 153 2.070000E-01 3.910000E-03 7.762000E-04 744 154 2.121000E-01 4.010000E-03 7.359000E-04 744 155 2.172000E-01 1.910000E-03 7.161000E-04 744 156 2.223000E-01 2.810000E-03 6.870000E-04 744 157 2.273000E-01 2.010000E-03 6.970000E-04 744 158 2.323000E-01 4.010000E-03 7.310000E-04 744 159 2.374000E-01 2.110000E-03 7.228000E-04 744 160 2.424000E-01 2.410000E-03 6.934000E-04 744 161 2.474000E-01 2.010000E-03 6.050000E-04 744 162 2.524000E-01 1.610000E-03 6.542000E-04 744 163 2.573000E-01 1.510000E-03 7.114000E-04 744 164 2.623000E-01 2.310000E-03 6.894000E-04 744 165 2.672000E-01 2.610000E-03 7.492000E-04 744 166 2.722000E-01 1.610000E-03 6.913000E-04 744 167 2.771000E-01 8.100000E-04 6.364000E-04 744 168 2.820000E-01 1.910000E-03 6.540000E-04 744 169 2.869000E-01 8.100000E-04 7.180000E-04 744 170 2.917000E-01 1.210000E-03 6.637000E-04 744 171 2.966000E-01 1.210000E-03 6.340000E-04 744 172 3.015000E-01 2.110000E-03 6.833000E-04 744 173 3.063000E-01 1.210000E-03 6.259000E-04 744 174 3.111000E-01 7.100000E-04 7.206000E-04 744 175 3.159000E-01 5.100000E-04 6.716000E-04 744 176 3.207000E-01 9.100000E-04 7.465000E-04 744 177 3.254000E-01 4.100000E-04 7.231000E-04 744 178 3.302000E-01 4.100000E-04 6.706000E-04 744 179 3.349000E-01 2.710000E-03 7.084000E-04 744 180 3.397000E-01 9.100000E-04 7.505000E-04 744 181 3.444000E-01 4.100000E-04 8.727000E-04 744 182 3.490000E-01 1.710000E-03 8.221000E-04 744 183 3.537000E-01 -9.000000E-05 7.128000E-04 744 184 3.584000E-01 1.210000E-03 7.954000E-04 744 185 3.630000E-01 2.110000E-03 7.780000E-04 744 186 3.676000E-01 -1.900000E-04 7.842000E-04 744 187 3.722000E-01 1.410000E-03 7.246000E-04 744 188 3.768000E-01 2.310000E-03 7.857000E-04 744 189 3.814000E-01 2.410000E-03 7.517000E-04 744 190 3.859000E-01 5.100000E-04 7.287000E-04 744 191 3.905000E-01 1.210000E-03 7.625000E-04 744 192 3.950000E-01 1.710000E-03 6.896000E-04 744 193 3.995000E-01 8.100000E-04 8.054000E-04 744 194 4.040000E-01 7.100000E-04 8.409000E-04 744 195 4.084000E-01 8.100000E-04 7.800000E-04 744 196 4.129000E-01 -9.000000E-05 8.074000E-04 744 197 4.173000E-01 1.610000E-03 8.242000E-04 744 198 4.217000E-01 1.710000E-03 8.692000E-04 744 199 4.261000E-01 1.110000E-03 7.502000E-04 744 200 4.305000E-01 1.210000E-03 7.470000E-04 744 201 4.348000E-01 1.100000E-04 8.041000E-04 744 202 4.392000E-01 7.100000E-04 8.245000E-04 744 203 4.435000E-01 9.100000E-04 8.651000E-04 744 204 4.478000E-01 1.510000E-03 8.941000E-04 744 205 4.521000E-01 3.100000E-04 8.811000E-04 744 206 4.563000E-01 -1.900000E-04 8.598000E-04 744 207 4.606000E-01 2.010000E-03 9.532000E-04 744 208 4.648000E-01 6.100000E-04 8.212000E-04 744 209 4.690000E-01 5.100000E-04 7.824000E-04 744 210 4.732000E-01 1.000000E-05 8.594000E-04 744 211 4.774000E-01 5.100000E-04 7.659000E-04 744 212 4.815000E-01 -3.900000E-04 8.373000E-04 744 213 4.856000E-01 -7.900000E-04 9.340000E-04 744 214 4.897000E-01 -1.650000E-03 9.397000E-04 744 215 4.938000E-01 7.100000E-04 8.870000E-04 744 216 4.979000E-01 7.100000E-04 7.709000E-04 744 217 5.020000E-01 1.000000E-05 8.943000E-04 744 218 5.060000E-01 4.100000E-04 7.586000E-04 744 219 5.100000E-01 -3.900000E-04 8.403000E-04 744 220 5.140000E-01 1.100000E-04 8.069000E-04 744 221 5.180000E-01 9.100000E-04 9.281000E-04 744 222 5.220000E-01 2.100000E-04 8.896000E-04 744 223 5.259000E-01 5.100000E-04 8.901000E-04 744 224 5.298000E-01 7.100000E-04 8.700000E-04 744 225 5.337000E-01 1.000000E-05 9.409000E-04 744 226 5.376000E-01 -9.900000E-04 9.677000E-04 744 227 5.415000E-01 -1.900000E-04 1.133000E-03 744 228 5.453000E-01 3.100000E-04 1.104000E-03 744 229 5.492000E-01 9.100000E-04 1.212000E-03 744 230 5.530000E-01 -3.900000E-04 1.184000E-03 744 231 5.568000E-01 -1.270000E-03 1.505000E-03 744 232 5.605000E-01 -5.900000E-04 1.486000E-03 744 233 5.643000E-01 -9.000000E-05 1.421000E-03 744 234 5.680000E-01 9.100000E-04 1.469000E-03 744 235 5.717000E-01 -9.900000E-04 1.994000E-03 744 236 5.754000E-01 -4.390000E-03 2.894000E-03 744 237 5.791000E-01 5.100000E-04 2.955000E-03 744 238 5.828000E-01 -2.400000E-03 2.886000E-03 744 239 5.864000E-01 3.510000E-03 4.507000E-03 744 240 5.900000E-01 4.510000E-03 4.141000E-03 744 241 5.936000E-01 -3.900000E-04 1.013000E-02 744 # _sas_p_of_R_details.id 744 _sas_p_of_R_details.intensity_id 744 _sas_p_of_R_details.software_p_of_R "GNOM 5.0" _sas_p_of_R_details.number_of_points 161 _sas_p_of_R_details.qmin 0.004706 _sas_p_of_R_details.qmax 0.2573 _sas_p_of_R_details.p_of_R_point_min 1 _sas_p_of_R_details.p_of_R_point_max 161 _sas_p_of_R_details.Rmin 0.0 _sas_p_of_R_details.Rmax 90.92 # loop_ _sas_p_of_R.id _sas_p_of_R.ordinal _sas_p_of_R.r _sas_p_of_R.P _sas_p_of_R.P_error 744 1 0.000000E+00 0.000000E+00 0.000000E+00 744 2 9.092000E-01 6.598000E-06 7.516000E-06 744 3 1.818000E+00 3.184000E-05 1.238000E-05 744 4 2.728000E+00 7.532000E-05 1.474000E-05 744 5 3.637000E+00 1.364000E-04 1.485000E-05 744 6 4.546000E+00 2.142000E-04 1.305000E-05 744 7 5.455000E+00 3.077000E-04 9.747000E-06 744 8 6.364000E+00 4.156000E-04 5.481000E-06 744 9 7.274000E+00 5.366000E-04 2.156000E-06 744 10 8.183000E+00 6.692000E-04 5.786000E-06 744 11 9.092000E+00 8.118000E-04 1.065000E-05 744 12 1.000000E+01 9.630000E-04 1.501000E-05 744 13 1.091000E+01 1.121000E-03 1.846000E-05 744 14 1.182000E+01 1.285000E-03 2.074000E-05 744 15 1.273000E+01 1.453000E-03 2.169000E-05 744 16 1.364000E+01 1.624000E-03 2.126000E-05 744 17 1.455000E+01 1.797000E-03 1.949000E-05 744 18 1.546000E+01 1.971000E-03 1.653000E-05 744 19 1.637000E+01 2.144000E-03 1.266000E-05 744 20 1.727000E+01 2.317000E-03 8.386000E-06 744 21 1.818000E+01 2.488000E-03 5.204000E-06 744 22 1.909000E+01 2.657000E-03 6.517000E-06 744 23 2.000000E+01 2.823000E-03 1.067000E-05 744 24 2.091000E+01 2.986000E-03 1.498000E-05 744 25 2.182000E+01 3.145000E-03 1.866000E-05 744 26 2.273000E+01 3.300000E-03 2.133000E-05 744 27 2.364000E+01 3.450000E-03 2.280000E-05 744 28 2.455000E+01 3.595000E-03 2.297000E-05 744 29 2.546000E+01 3.734000E-03 2.183000E-05 744 30 2.637000E+01 3.866000E-03 1.951000E-05 744 31 2.728000E+01 3.991000E-03 1.627000E-05 744 32 2.819000E+01 4.108000E-03 1.258000E-05 744 33 2.909000E+01 4.216000E-03 9.481000E-06 744 34 3.000000E+01 4.315000E-03 8.891000E-06 744 35 3.091000E+01 4.404000E-03 1.148000E-05 744 36 3.182000E+01 4.482000E-03 1.545000E-05 744 37 3.273000E+01 4.548000E-03 1.942000E-05 744 38 3.364000E+01 4.602000E-03 2.275000E-05 744 39 3.455000E+01 4.644000E-03 2.506000E-05 744 40 3.546000E+01 4.674000E-03 2.616000E-05 744 41 3.637000E+01 4.691000E-03 2.597000E-05 744 42 3.728000E+01 4.696000E-03 2.452000E-05 744 43 3.819000E+01 4.688000E-03 2.198000E-05 744 44 3.910000E+01 4.669000E-03 1.868000E-05 744 45 4.000000E+01 4.638000E-03 1.522000E-05 744 46 4.091000E+01 4.597000E-03 1.265000E-05 744 47 4.182000E+01 4.546000E-03 1.233000E-05 744 48 4.273000E+01 4.487000E-03 1.451000E-05 744 49 4.364000E+01 4.420000E-03 1.795000E-05 744 50 4.455000E+01 4.346000E-03 2.149000E-05 744 51 4.546000E+01 4.266000E-03 2.441000E-05 744 52 4.637000E+01 4.181000E-03 2.633000E-05 744 53 4.728000E+01 4.091000E-03 2.705000E-05 744 54 4.819000E+01 3.998000E-03 2.652000E-05 744 55 4.910000E+01 3.902000E-03 2.484000E-05 744 56 5.001000E+01 3.804000E-03 2.229000E-05 744 57 5.092000E+01 3.703000E-03 1.941000E-05 744 58 5.182000E+01 3.600000E-03 1.705000E-05 744 59 5.273000E+01 3.495000E-03 1.630000E-05 744 60 5.364000E+01 3.388000E-03 1.777000E-05 744 61 5.455000E+01 3.279000E-03 2.086000E-05 744 62 5.546000E+01 3.167000E-03 2.453000E-05 744 63 5.637000E+01 3.054000E-03 2.794000E-05 744 64 5.728000E+01 2.938000E-03 3.056000E-05 744 65 5.819000E+01 2.819000E-03 3.205000E-05 744 66 5.910000E+01 2.698000E-03 3.226000E-05 744 67 6.001000E+01 2.575000E-03 3.120000E-05 744 68 6.092000E+01 2.450000E-03 2.902000E-05 744 69 6.183000E+01 2.323000E-03 2.611000E-05 744 70 6.273000E+01 2.196000E-03 2.308000E-05 744 71 6.364000E+01 2.068000E-03 2.079000E-05 744 72 6.455000E+01 1.941000E-03 2.015000E-05 744 73 6.546000E+01 1.816000E-03 2.145000E-05 744 74 6.637000E+01 1.693000E-03 2.406000E-05 744 75 6.728000E+01 1.574000E-03 2.703000E-05 744 76 6.819000E+01 1.459000E-03 2.957000E-05 744 77 6.910000E+01 1.349000E-03 3.117000E-05 744 78 7.001000E+01 1.244000E-03 3.158000E-05 744 79 7.092000E+01 1.147000E-03 3.079000E-05 744 80 7.183000E+01 1.055000E-03 2.907000E-05 744 81 7.274000E+01 9.710000E-04 2.695000E-05 744 82 7.365000E+01 8.931000E-04 2.529000E-05 744 83 7.455000E+01 8.216000E-04 2.504000E-05 744 84 7.546000E+01 7.557000E-04 2.665000E-05 744 85 7.637000E+01 6.949000E-04 2.974000E-05 744 86 7.728000E+01 6.381000E-04 3.339000E-05 744 87 7.819000E+01 5.845000E-04 3.669000E-05 744 88 7.910000E+01 5.330000E-04 3.899000E-05 744 89 8.001000E+01 4.827000E-04 3.994000E-05 744 90 8.092000E+01 4.327000E-04 3.954000E-05 744 91 8.183000E+01 3.825000E-04 3.826000E-05 744 92 8.274000E+01 3.317000E-04 3.705000E-05 744 93 8.365000E+01 2.803000E-04 3.718000E-05 744 94 8.456000E+01 2.287000E-04 3.949000E-05 744 95 8.546000E+01 1.778000E-04 4.366000E-05 744 96 8.637000E+01 1.289000E-04 4.816000E-05 744 97 8.728000E+01 8.408000E-05 5.094000E-05 744 98 8.819000E+01 4.562000E-05 4.978000E-05 744 99 8.910000E+01 1.648000E-05 4.242000E-05 744 100 9.001000E+01 1.428000E-08 2.658000E-05 744 101 9.092000E+01 0.000000E+00 0.000000E+00 # loop_ _sas_p_of_R_extrapolated_intensity.id _sas_p_of_R_extrapolated_intensity.ordinal _sas_p_of_R_extrapolated_intensity.momentum_transfer _sas_p_of_R_extrapolated_intensity.intensity_reg 744 1 0.000000E+00 2.621470E+00 744 2 3.921670E-04 2.621340E+00 744 3 7.843330E-04 2.620950E+00 744 4 1.176500E-03 2.620290E+00 744 5 1.568670E-03 2.619380E+00 744 6 1.960830E-03 2.618200E+00 744 7 2.353000E-03 2.616760E+00 744 8 2.745170E-03 2.615060E+00 744 9 3.137330E-03 2.613100E+00 744 10 3.529500E-03 2.610890E+00 744 11 3.921670E-03 2.608410E+00 744 12 4.313830E-03 2.605670E+00 744 13 4.706000E-03 2.602680E+00 744 14 5.115000E-03 2.599290E+00 744 15 5.524000E-03 2.595610E+00 744 16 5.934000E-03 2.591650E+00 744 17 6.343000E-03 2.587430E+00 744 18 6.752000E-03 2.582930E+00 744 19 7.161000E-03 2.578150E+00 744 20 7.570000E-03 2.573110E+00 744 21 7.979000E-03 2.567790E+00 744 22 8.389000E-03 2.562190E+00 744 23 8.798000E-03 2.556340E+00 744 24 9.207000E-03 2.550220E+00 744 25 9.616000E-03 2.543850E+00 744 26 1.003000E-02 2.537120E+00 744 27 1.043000E-02 2.530370E+00 744 28 1.084000E-02 2.523200E+00 744 29 1.125000E-02 2.515770E+00 744 30 1.166000E-02 2.508090E+00 744 31 1.207000E-02 2.500150E+00 744 32 1.248000E-02 2.491970E+00 744 33 1.263000E-02 2.488910E+00 744 34 1.289000E-02 2.483540E+00 744 35 1.330000E-02 2.474860E+00 744 36 1.371000E-02 2.465940E+00 744 37 1.396000E-02 2.460390E+00 744 38 1.412000E-02 2.456790E+00 744 39 1.453000E-02 2.447390E+00 744 40 1.494000E-02 2.437770E+00 744 41 1.529000E-02 2.429370E+00 744 42 1.534000E-02 2.428150E+00 744 43 1.575000E-02 2.418070E+00 744 44 1.616000E-02 2.407770E+00 744 45 1.657000E-02 2.397240E+00 744 46 1.662000E-02 2.395940E+00 744 47 1.698000E-02 2.386500E+00 744 48 1.739000E-02 2.375540E+00 744 49 1.780000E-02 2.364360E+00 744 50 1.795000E-02 2.360220E+00 744 51 1.821000E-02 2.352980E+00 744 52 1.862000E-02 2.341390E+00 744 53 1.903000E-02 2.329600E+00 744 54 1.928000E-02 2.322310E+00 744 55 1.944000E-02 2.317610E+00 744 56 1.984000E-02 2.305720E+00 744 57 2.025000E-02 2.293350E+00 744 58 2.061000E-02 2.282330E+00 744 59 2.066000E-02 2.280790E+00 744 60 2.107000E-02 2.268040E+00 744 61 2.148000E-02 2.255110E+00 744 62 2.189000E-02 2.242010E+00 744 63 2.194000E-02 2.240400E+00 744 64 2.230000E-02 2.228730E+00 744 65 2.271000E-02 2.215280E+00 744 66 2.312000E-02 2.201660E+00 744 67 2.327000E-02 2.196640E+00 744 68 2.353000E-02 2.187880E+00 744 69 2.393000E-02 2.174280E+00 744 70 2.434000E-02 2.160190E+00 744 71 2.460000E-02 2.151180E+00 744 72 2.475000E-02 2.145950E+00 744 73 2.516000E-02 2.131560E+00 744 74 2.557000E-02 2.117030E+00 744 75 2.593000E-02 2.104160E+00 744 76 2.598000E-02 2.102360E+00 744 77 2.639000E-02 2.087550E+00 744 78 2.680000E-02 2.072620E+00 744 79 2.721000E-02 2.057550E+00 744 80 2.726000E-02 2.055710E+00 744 81 2.761000E-02 2.042740E+00 744 82 2.802000E-02 2.027430E+00 744 83 2.843000E-02 2.012010E+00 744 84 2.859000E-02 2.005970E+00 744 85 2.884000E-02 1.996480E+00 744 86 2.925000E-02 1.980850E+00 744 87 2.966000E-02 1.965110E+00 744 88 2.991000E-02 1.955460E+00 744 89 3.124000E-02 1.903570E+00 744 90 3.257000E-02 1.850810E+00 744 91 3.390000E-02 1.797320E+00 744 92 3.523000E-02 1.743240E+00 744 93 3.656000E-02 1.688710E+00 744 94 3.788000E-02 1.634280E+00 744 95 3.921000E-02 1.579260E+00 744 96 4.054000E-02 1.524190E+00 744 97 4.187000E-02 1.469210E+00 744 98 4.320000E-02 1.414430E+00 744 99 4.452000E-02 1.360380E+00 744 100 4.585000E-02 1.306360E+00 744 101 4.718000E-02 1.252880E+00 744 102 4.850000E-02 1.200460E+00 744 103 4.983000E-02 1.148390E+00 744 104 5.116000E-02 1.097160E+00 744 105 5.248000E-02 1.047240E+00 744 106 5.381000E-02 9.979540E-01 744 107 5.514000E-02 9.497500E-01 744 108 5.646000E-02 9.030490E-01 744 109 5.779000E-02 8.572040E-01 744 110 5.911000E-02 8.129570E-01 744 111 6.044000E-02 7.696860E-01 744 112 6.176000E-02 7.280800E-01 744 113 6.309000E-02 6.875450E-01 744 114 6.441000E-02 6.487160E-01 744 115 6.573000E-02 6.113040E-01 744 116 6.706000E-02 5.750590E-01 744 117 6.838000E-02 5.405340E-01 744 118 6.971000E-02 5.072090E-01 744 119 7.103000E-02 4.755840E-01 744 120 7.235000E-02 4.453970E-01 744 121 7.367000E-02 4.166350E-01 744 122 7.500000E-02 3.890810E-01 744 123 7.632000E-02 3.631280E-01 744 124 7.764000E-02 3.385390E-01 744 125 7.896000E-02 3.152860E-01 744 126 8.028000E-02 2.933380E-01 744 127 8.161000E-02 2.725080E-01 744 128 8.227000E-02 2.626390E-01 744 129 8.293000E-02 2.530730E-01 744 130 8.425000E-02 2.348320E-01 744 131 8.557000E-02 2.177440E-01 744 132 8.689000E-02 2.017640E-01 744 133 8.755000E-02 1.941770E-01 744 134 8.821000E-02 1.868500E-01 744 135 8.952000E-02 1.730580E-01 744 136 9.084000E-02 1.601300E-01 744 137 9.216000E-02 1.481290E-01 744 138 9.282000E-02 1.424620E-01 744 139 9.348000E-02 1.370080E-01 744 140 9.480000E-02 1.267210E-01 744 141 9.612000E-02 1.172210E-01 744 142 9.809000E-02 1.044070E-01 744 143 1.034000E-01 7.693470E-02 744 144 1.086000E-01 5.798940E-02 744 145 1.139000E-01 4.449630E-02 744 146 1.191000E-01 3.517750E-02 744 147 1.244000E-01 2.830180E-02 744 148 1.296000E-01 2.320120E-02 744 149 1.348000E-01 1.914730E-02 744 150 1.400000E-01 1.581160E-02 744 151 1.452000E-01 1.303220E-02 744 152 1.504000E-01 1.074000E-02 744 153 1.556000E-01 8.902980E-03 744 154 1.608000E-01 7.489620E-03 744 155 1.660000E-01 6.450690E-03 744 156 1.712000E-01 5.716820E-03 744 157 1.763000E-01 5.214270E-03 744 158 1.815000E-01 4.842400E-03 744 159 1.866000E-01 4.547970E-03 744 160 1.917000E-01 4.275620E-03 744 161 1.968000E-01 4.000550E-03 744 162 2.019000E-01 3.718540E-03 744 163 2.070000E-01 3.440040E-03 744 164 2.121000E-01 3.182150E-03 744 165 2.172000E-01 2.960450E-03 744 166 2.223000E-01 2.782420E-03 744 167 2.273000E-01 2.646250E-03 744 168 2.323000E-01 2.532990E-03 744 169 2.374000E-01 2.417000E-03 744 170 2.424000E-01 2.275910E-03 744 171 2.474000E-01 2.083600E-03 744 172 2.524000E-01 1.824130E-03 744 173 2.573000E-01 1.500630E-03 #