data_SASDDA3_MAIN # _sas_result.id 809 _sas_result.SASBDB_code SASDDA3 _sas_result.experimental_MW 1400.000 _sas_result.experimental_MW_error . _sas_result.MW_standard . _sas_result.MW_standard_error . _sas_result.MW_Porod 1400.000 _sas_result.MW_Porod_error . _sas_result.I0_from_PR 152.0000000000 _sas_result.I0_from_PR_error 0.1000000000 _sas_result.I0_from_Guinier 151.1600000000 _sas_result.I0_from_Guinier_error 0.3700000000 _sas_result.Rg_from_PR 7.984 _sas_result.Rg_from_PR_error 0.070 _sas_result.Rg_from_Guinier 7.890 _sas_result.Rg_from_Guinier_error 0.070 _sas_result.D_max 25.10 _sas_result.Porod_volume 2416.00 _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min 1 _sas_result.Guinier_point_max 15 _sas_result.type_of_curve other _sas_result.standard . _sas_result.Dmax_error . _sas_result.comments . # _sas_scan.title "ATP-dependent Clp protease ATP-binding subunit ClpC1, second state" _sas_scan.detc_id 16 _sas_scan.id 809 _sas_scan.measurement_date 2017-09-18 _sas_scan.storage_temperature 20.0 _sas_scan.cell_temperature 20.0 _sas_scan.exposure_time 1.000 _sas_scan.number_of_frames 50 _sas_scan.unit 1/nm _sas_scan.qmin 0.0949 _sas_scan.qmax 1.4431 _sas_scan.sample_id 769 _sas_scan.result_id 809 _sas_scan.beam_id 10 # _sas_beam.id 10 _sas_beam.instrument_name "ESRF BM29" _sas_beam.instrument_city Grenoble _sas_beam.instrument_country France _sas_beam.shape . _sas_beam.type_of_source "X-ray synchrotron" _sas_beam.radiation_wavelength 0.099000 _sas_beam.dist_spec_to_detc 2.86700 # _sas_detc.id 16 _sas_detc.name "Pilatus 1M" _sas_detc.type . _sas_detc.pixsize_x . # _sas_sample.id 769 _sas_sample.name "ATP-dependent Clp protease ATP-binding subunit ClpC1, second state" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration . _sas_sample.concentration_method . _sas_sample.entity_id 957 # _sas_buffer.id 467 _sas_buffer.name "Hepes 50 mM pH 7.5, KCl 100 mM, glycerol 10%, MgCl2 4 mM and ATP 1 mM" _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.500 _sas_buffer.comment . _sas_buffer.composition . _sas_buffer.sample_id 769 # _entity.id 957 _entity.type protein _entity.pdbx_description "ATP-dependent Clp protease ATP-binding subunit ClpC1" _entity.formula_weight 94.518 _entity.pdbx_number_of_molecules . # _entity_name_com.entity_id 957 _entity_name_com.name ClpC1 # _entity_poly.entity_id 957 _entity_poly.pdbx_seq_one_letter_code ;MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVR SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA AQVLVKLGAELTRVRQQVIQLLSGYQGKEAAEAGTGGRGGESGSPSTSLVLDQFGRNLTA AAMEGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGEVPE TLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEG AIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAALERRFQPVQVGEPTVEHTIEILK GLRDRYEAHHRVSITDAAMVAAATLADRYINDRFLPDKAIDLIDEAGARMRIRRMTAPPD LREFDEKIAEARREKESAIDAQDFEKAASLRDREKTLVAQRAEREKQWRSGDLDVVAEVD DEQIAEVLGNWTGIPVFKLTEAETTRLLRMEEELHKRIIGQEDAVKAVSKAIRRTRAGLK DPKRPSGSFIFAGPSGVGKTELSKALANFLFGDDDALIQIDMGEFHDRFTASRLFGAPPG YVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNSLLQVLEDGRLTDGQGRTVDFKNT VLIFTSNLGTSDISKPVGLGFSKGGGENDYERMKQKVNDELKKHFRPEFLNRIDDIIVFH QLTREEIIRMVDLMISRVAGQLKSKDMALVLTDAAKALLAKRGFDPVLGARPLRRTIQRE IEDQLSEKILFEEVGPGQVVTVDVDNWDGEGPGEDAVFTFTGTRKPPAEPDLAKAGAHSA GGPEPAARGSHHHHHH ; # _entity_src_gen.entity_id 957 _entity_src_gen.gene_src_common_name "Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)" # _struct_ref.id 1 _struct_ref.entity_id 957 _struct_ref.db_name UniProt _struct_ref.db_code P9WPC9 _struct_ref.details http://www.uniprot.org/uniprot/P9WPC9 # _citation.id 346 _citation.title "The antibiotic cyclomarin blocks arginine-phosphate–induced millisecond dynamics in the N-terminal domain of ClpC1 fromMycobacterium tuberculosis" _citation.year "2018 Jun 1" _citation.pdbx_database_id_DOI 10.1074/jbc.RA118.002251 _citation.pdbx_database_id_PubMed . # loop_ _citation_author.citation_id _citation_author.ordinal _citation_author.name 346 1 "Weinhäupl K" 346 2 "Brennich M" 346 3 "Kazmaier U" 346 4 "Lelievre J" 346 5 "Ballell L" 346 6 "Goldberg A" 346 7 "Schanda P" # _pdbx_contact_author.id 68 _pdbx_contact_author.name_first Martha _pdbx_contact_author.name_last Brennich _pdbx_contact_author.role . _pdbx_contact_author.address_1 EMBL _pdbx_contact_author.address_2 "European Molecular Biology Laboratory (EMBL) - Grenoble Outstation" _pdbx_contact_author.address_3 "Grenoble, France" # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 9.487380E-02 1.247924E+02 2.256573E-01 809 2 9.957151E-02 1.225763E+02 2.170435E-01 809 3 1.042692E-01 1.208374E+02 2.037097E-01 809 4 1.089669E-01 1.180913E+02 2.058721E-01 809 5 1.136647E-01 1.159841E+02 1.873630E-01 809 6 1.183624E-01 1.134272E+02 1.761173E-01 809 7 1.230601E-01 1.104869E+02 1.709374E-01 809 8 1.277578E-01 1.080824E+02 1.737940E-01 809 9 1.324555E-01 1.048034E+02 1.645621E-01 809 10 1.371532E-01 1.027254E+02 1.525289E-01 809 11 1.418509E-01 9.943164E+01 1.484750E-01 809 12 1.465486E-01 9.665143E+01 1.481636E-01 809 13 1.512464E-01 9.429372E+01 1.437445E-01 809 14 1.559441E-01 9.118003E+01 1.346327E-01 809 15 1.606418E-01 8.836087E+01 1.305464E-01 809 16 1.653395E-01 8.585407E+01 1.288092E-01 809 17 1.700372E-01 8.281073E+01 1.297186E-01 809 18 1.747349E-01 8.009860E+01 1.202215E-01 809 19 1.794327E-01 7.755458E+01 1.164467E-01 809 20 1.841304E-01 7.478558E+01 1.159548E-01 809 21 1.888281E-01 7.198520E+01 1.157572E-01 809 22 1.935258E-01 6.962467E+01 1.093617E-01 809 23 1.982235E-01 6.684239E+01 1.034885E-01 809 24 2.029212E-01 6.446393E+01 1.030495E-01 809 25 2.076189E-01 6.222513E+01 1.035744E-01 809 26 2.123167E-01 5.962669E+01 9.989895E-02 809 27 2.170144E-01 5.716048E+01 9.218227E-02 809 28 2.217121E-01 5.495346E+01 9.478106E-02 809 29 2.264098E-01 5.261514E+01 9.188063E-02 809 30 2.311075E-01 5.058931E+01 9.233981E-02 809 31 2.358052E-01 4.841396E+01 8.442869E-02 809 32 2.405029E-01 4.625857E+01 8.523835E-02 809 33 2.452006E-01 4.425002E+01 8.332044E-02 809 34 2.498984E-01 4.244826E+01 8.430365E-02 809 35 2.545961E-01 4.052075E+01 7.710168E-02 809 36 2.592938E-01 3.855961E+01 7.658339E-02 809 37 2.639915E-01 3.683978E+01 7.736848E-02 809 38 2.686892E-01 3.527205E+01 7.658499E-02 809 39 2.733869E-01 3.370388E+01 7.131045E-02 809 40 2.780846E-01 3.181958E+01 7.081528E-02 809 41 2.827824E-01 3.053836E+01 7.045629E-02 809 42 2.874801E-01 2.902481E+01 7.006200E-02 809 43 2.921778E-01 2.761957E+01 6.854303E-02 809 44 2.968755E-01 2.633816E+01 6.380716E-02 809 45 3.015732E-01 2.502483E+01 6.518248E-02 809 46 3.062709E-01 2.370857E+01 6.406496E-02 809 47 3.109686E-01 2.253829E+01 6.428008E-02 809 48 3.156663E-01 2.142656E+01 5.939739E-02 809 49 3.203641E-01 2.043632E+01 6.084299E-02 809 50 3.250618E-01 1.935691E+01 5.880728E-02 809 51 3.297595E-01 1.847441E+01 6.027981E-02 809 52 3.344572E-01 1.753675E+01 5.651778E-02 809 53 3.391549E-01 1.665360E+01 5.636027E-02 809 54 3.438526E-01 1.586090E+01 5.706169E-02 809 55 3.485504E-01 1.509919E+01 5.668197E-02 809 56 3.532481E-01 1.434226E+01 5.653958E-02 809 57 3.579458E-01 1.357098E+01 5.768961E-02 809 58 3.626435E-01 1.283981E+01 5.925337E-02 809 59 3.673412E-01 1.205703E+01 5.821065E-02 809 60 3.720389E-01 1.162935E+01 5.902979E-02 809 61 3.767366E-01 1.095863E+01 5.787846E-02 809 62 3.814343E-01 1.037640E+01 5.924240E-02 809 63 3.861321E-01 9.818642E+00 5.930752E-02 809 64 3.908298E-01 9.365367E+00 5.913669E-02 809 65 3.955275E-01 8.902136E+00 6.151105E-02 809 66 4.002252E-01 8.492073E+00 6.144869E-02 809 67 4.049229E-01 7.922756E+00 6.286510E-02 809 68 4.096206E-01 7.595407E+00 6.368279E-02 809 69 4.143183E-01 7.278531E+00 6.448702E-02 809 70 4.190160E-01 6.767762E+00 6.544033E-02 809 71 4.237138E-01 6.521476E+00 6.562913E-02 809 72 4.284115E-01 6.092300E+00 6.872215E-02 809 73 4.331092E-01 5.916378E+00 6.779001E-02 809 74 4.378069E-01 5.507952E+00 6.845505E-02 809 75 4.425046E-01 5.334244E+00 7.026976E-02 809 76 4.472023E-01 5.019544E+00 7.059275E-02 809 77 4.519000E-01 4.627171E+00 7.140889E-02 809 78 4.565978E-01 4.628512E+00 6.928803E-02 809 79 4.612955E-01 4.198484E+00 6.571885E-02 809 80 4.659932E-01 4.054782E+00 6.609683E-02 809 81 4.706909E-01 3.864600E+00 6.646033E-02 809 82 4.753886E-01 3.855808E+00 6.308612E-02 809 83 4.800863E-01 3.510548E+00 6.221599E-02 809 84 4.847840E-01 3.422703E+00 6.298681E-02 809 85 4.894817E-01 3.279801E+00 6.395745E-02 809 86 4.941795E-01 2.986260E+00 6.057145E-02 809 87 4.988772E-01 2.814060E+00 6.075293E-02 809 88 5.035749E-01 2.784487E+00 6.157039E-02 809 89 5.082726E-01 2.550314E+00 6.188532E-02 809 90 5.129703E-01 2.597900E+00 5.911967E-02 809 91 5.176680E-01 2.398219E+00 5.899247E-02 809 92 5.223657E-01 2.231886E+00 5.921580E-02 809 93 5.270635E-01 2.068070E+00 6.092126E-02 809 94 5.317612E-01 2.189630E+00 5.764406E-02 809 95 5.364589E-01 1.792744E+00 5.754284E-02 809 96 5.411566E-01 1.910592E+00 5.689323E-02 809 97 5.458543E-01 1.713620E+00 5.844295E-02 809 98 5.505520E-01 1.803873E+00 5.752771E-02 809 99 5.552497E-01 1.702367E+00 5.522262E-02 809 100 5.599474E-01 1.572087E+00 5.589695E-02 809 101 5.646452E-01 1.562332E+00 5.655710E-02 809 102 5.693429E-01 1.481884E+00 5.563816E-02 809 103 5.740406E-01 1.541371E+00 5.351025E-02 809 104 5.787383E-01 1.423879E+00 5.510963E-02 809 105 5.834360E-01 1.387527E+00 5.478895E-02 809 106 5.881338E-01 1.403304E+00 5.491340E-02 809 107 5.928314E-01 1.232610E+00 5.342462E-02 809 108 5.975292E-01 1.302420E+00 5.389137E-02 809 109 6.022268E-01 1.196968E+00 5.431801E-02 809 110 6.069246E-01 1.142149E+00 5.558762E-02 809 111 6.116223E-01 1.250478E+00 5.280736E-02 809 112 6.163200E-01 1.175955E+00 5.306931E-02 809 113 6.210178E-01 1.215030E+00 5.405912E-02 809 114 6.257154E-01 1.077701E+00 5.361428E-02 809 115 6.304132E-01 1.091962E+00 5.322434E-02 809 116 6.351109E-01 1.125727E+00 5.207258E-02 809 117 6.398086E-01 1.097693E+00 5.300739E-02 809 118 6.445063E-01 9.057080E-01 5.302686E-02 809 119 6.492040E-01 1.097672E+00 5.353973E-02 809 120 6.539018E-01 9.907336E-01 5.170188E-02 809 121 6.585994E-01 9.741684E-01 5.267085E-02 809 122 6.632972E-01 9.326890E-01 5.245522E-02 809 123 6.679949E-01 9.461087E-01 5.274458E-02 809 124 6.726926E-01 9.619379E-01 5.150425E-02 809 125 6.773903E-01 9.452592E-01 5.141273E-02 809 126 6.820880E-01 9.974642E-01 5.170414E-02 809 127 6.867858E-01 1.029993E+00 5.230694E-02 809 128 6.914834E-01 1.043658E+00 5.127132E-02 809 129 6.961812E-01 9.048874E-01 5.102891E-02 809 130 7.008789E-01 1.043736E+00 5.129343E-02 809 131 7.055766E-01 9.770184E-01 5.228187E-02 809 132 7.102743E-01 8.069529E-01 5.079987E-02 809 133 7.149720E-01 9.864971E-01 5.098612E-02 809 134 7.196697E-01 9.808820E-01 5.081588E-02 809 135 7.243674E-01 1.015773E+00 5.107341E-02 809 136 7.290652E-01 8.649760E-01 5.181105E-02 809 137 7.337629E-01 8.658505E-01 4.930831E-02 809 138 7.384606E-01 8.670638E-01 5.021497E-02 809 139 7.431583E-01 8.530971E-01 5.067453E-02 809 140 7.478560E-01 8.428177E-01 5.095853E-02 809 141 7.525537E-01 9.261587E-01 4.983877E-02 809 142 7.572514E-01 7.843582E-01 4.899329E-02 809 143 7.619491E-01 8.156997E-01 5.053815E-02 809 144 7.666469E-01 8.852684E-01 5.096759E-02 809 145 7.713446E-01 9.595488E-01 4.960345E-02 809 146 7.760423E-01 9.378153E-01 4.892369E-02 809 147 7.807400E-01 9.192894E-01 4.973994E-02 809 148 7.854377E-01 8.134232E-01 4.995435E-02 809 149 7.901354E-01 7.556635E-01 4.910555E-02 809 150 7.948331E-01 9.340451E-01 4.871564E-02 809 151 7.995309E-01 9.014340E-01 4.919850E-02 809 152 8.042285E-01 8.128169E-01 4.941985E-02 809 153 8.089263E-01 8.037577E-01 4.984158E-02 809 154 8.136240E-01 7.538791E-01 4.792297E-02 809 155 8.183217E-01 8.234797E-01 4.853065E-02 809 156 8.230194E-01 6.874591E-01 4.895734E-02 809 157 8.277171E-01 8.466525E-01 4.944653E-02 809 158 8.324149E-01 7.571245E-01 4.730971E-02 809 159 8.371125E-01 7.092052E-01 4.808510E-02 809 160 8.418103E-01 6.974037E-01 4.856887E-02 809 161 8.465080E-01 7.011078E-01 4.897791E-02 809 162 8.512057E-01 6.624902E-01 4.709243E-02 809 163 8.559035E-01 6.998963E-01 4.755997E-02 809 164 8.606011E-01 6.734928E-01 4.822942E-02 809 165 8.652989E-01 6.977567E-01 4.839899E-02 809 166 8.699965E-01 7.292408E-01 4.744121E-02 809 167 8.746943E-01 5.996622E-01 4.685781E-02 809 168 8.793920E-01 6.131400E-01 4.780855E-02 809 169 8.840897E-01 5.096155E-01 4.742907E-02 809 170 8.887874E-01 5.831482E-01 4.756982E-02 809 171 8.934851E-01 5.617429E-01 4.636354E-02 809 172 8.981829E-01 4.441043E-01 4.731656E-02 809 173 9.028806E-01 4.896514E-01 4.708344E-02 809 174 9.075783E-01 6.147582E-01 4.749786E-02 809 175 9.122760E-01 5.891831E-01 4.585397E-02 809 176 9.169737E-01 3.667371E-01 4.703165E-02 809 177 9.216714E-01 3.905451E-01 4.693597E-02 809 178 9.263691E-01 6.620486E-01 4.664449E-02 809 179 9.310669E-01 4.621461E-01 4.572321E-02 809 180 9.357646E-01 4.379517E-01 4.637095E-02 809 181 9.404623E-01 5.366501E-01 4.664664E-02 809 182 9.451600E-01 4.778979E-01 4.616201E-02 809 183 9.498577E-01 5.021837E-01 4.595379E-02 809 184 9.545554E-01 4.912910E-01 4.568633E-02 809 185 9.592531E-01 4.461860E-01 4.619309E-02 809 186 9.639508E-01 5.267542E-01 4.620307E-02 809 187 9.686486E-01 4.441020E-01 4.563348E-02 809 188 9.733463E-01 4.185603E-01 4.520582E-02 809 189 9.780440E-01 3.874630E-01 4.571106E-02 809 190 9.827417E-01 4.541782E-01 4.557050E-02 809 191 9.874394E-01 4.331259E-01 4.619403E-02 809 192 9.921371E-01 5.245705E-01 4.413848E-02 809 193 9.968348E-01 4.005185E-01 4.549942E-02 809 194 1.001533E+00 4.421025E-01 4.522064E-02 809 195 1.006230E+00 4.173423E-01 4.576142E-02 809 196 1.010928E+00 3.907195E-01 4.465134E-02 809 197 1.015626E+00 5.547874E-01 4.454662E-02 809 198 1.020323E+00 5.190537E-01 4.514616E-02 809 199 1.025021E+00 4.169594E-01 4.510173E-02 809 200 1.029719E+00 4.760996E-01 4.453794E-02 809 201 1.034417E+00 4.582860E-01 4.449729E-02 809 202 1.039114E+00 3.526230E-01 4.444368E-02 809 203 1.043812E+00 4.918061E-01 4.485835E-02 809 204 1.048510E+00 4.392217E-01 4.433781E-02 809 205 1.053207E+00 4.508475E-01 4.396661E-02 809 206 1.057905E+00 4.049385E-01 4.457244E-02 809 207 1.062603E+00 3.718695E-01 4.434944E-02 809 208 1.067301E+00 5.375633E-01 4.463281E-02 809 209 1.071998E+00 4.762373E-01 4.328257E-02 809 210 1.076696E+00 5.188717E-01 4.430509E-02 809 211 1.081394E+00 4.474810E-01 4.389956E-02 809 212 1.086091E+00 5.425855E-01 4.458536E-02 809 213 1.090789E+00 5.212188E-01 4.320769E-02 809 214 1.095487E+00 4.620352E-01 4.310659E-02 809 215 1.100185E+00 3.869536E-01 4.405318E-02 809 216 1.104882E+00 5.633347E-01 4.411679E-02 809 217 1.109580E+00 4.849800E-01 4.284638E-02 809 218 1.114278E+00 3.525589E-01 4.327770E-02 809 219 1.118975E+00 4.604160E-01 4.327688E-02 809 220 1.123673E+00 4.531836E-01 4.400323E-02 809 221 1.128371E+00 3.607953E-01 4.314608E-02 809 222 1.133069E+00 5.727452E-01 4.273928E-02 809 223 1.137766E+00 4.453245E-01 4.313890E-02 809 224 1.142464E+00 3.582859E-01 4.322635E-02 809 225 1.147162E+00 4.571002E-01 4.321393E-02 809 226 1.151859E+00 4.564643E-01 4.235261E-02 809 227 1.156557E+00 4.629439E-01 4.257520E-02 809 228 1.161255E+00 4.751180E-01 4.282638E-02 809 229 1.165953E+00 3.987931E-01 4.358683E-02 809 230 1.170650E+00 4.449194E-01 4.186005E-02 809 231 1.175348E+00 3.811159E-01 4.207395E-02 809 232 1.180046E+00 4.577223E-01 4.292646E-02 809 233 1.184743E+00 3.131275E-01 4.320513E-02 809 234 1.189441E+00 4.191057E-01 4.153570E-02 809 235 1.194139E+00 4.868828E-01 4.240574E-02 809 236 1.198837E+00 3.263925E-01 4.356482E-02 809 237 1.203534E+00 2.882044E-01 4.470790E-02 809 238 1.208232E+00 3.751336E-01 4.491769E-02 809 239 1.212930E+00 3.778745E-01 4.554446E-02 809 240 1.217627E+00 3.720400E-01 4.605244E-02 809 241 1.222325E+00 4.463414E-01 4.714293E-02 809 242 1.227023E+00 4.137715E-01 4.750690E-02 809 243 1.231721E+00 2.738724E-01 4.717261E-02 809 244 1.236418E+00 3.568423E-01 4.829827E-02 809 245 1.241116E+00 3.991766E-01 4.853770E-02 809 246 1.245814E+00 3.078123E-01 4.928263E-02 809 247 1.250511E+00 3.095034E-01 4.775904E-02 809 248 1.255209E+00 3.668666E-01 4.874398E-02 809 249 1.259907E+00 2.448122E-01 4.914000E-02 809 250 1.264605E+00 3.876993E-01 4.762021E-02 809 251 1.269302E+00 2.494575E-01 4.528618E-02 809 252 1.274000E+00 3.303407E-01 4.516093E-02 809 253 1.278698E+00 3.728101E-01 4.516011E-02 809 254 1.283395E+00 2.384285E-01 4.436230E-02 809 255 1.288093E+00 2.528227E-01 4.327639E-02 809 256 1.292791E+00 3.181161E-01 4.331856E-02 809 257 1.297489E+00 2.363409E-01 4.333676E-02 809 258 1.302186E+00 2.970607E-01 4.269888E-02 809 259 1.306884E+00 2.544262E-01 4.217920E-02 809 260 1.311582E+00 2.956557E-01 4.206156E-02 809 261 1.316279E+00 2.728299E-01 4.229475E-02 809 262 1.320977E+00 2.518372E-01 4.238845E-02 809 263 1.325675E+00 3.336600E-01 4.198455E-02 809 264 1.330373E+00 1.144853E-01 4.126814E-02 809 265 1.335070E+00 1.965516E-01 4.193286E-02 809 266 1.339768E+00 2.520597E-01 4.174499E-02 809 267 1.344466E+00 1.609852E-01 4.196248E-02 809 268 1.349163E+00 3.147781E-01 4.120871E-02 809 269 1.353861E+00 2.747433E-01 4.108817E-02 809 270 1.358559E+00 1.947787E-01 4.133874E-02 809 271 1.363257E+00 2.415476E-01 4.144157E-02 809 272 1.367954E+00 1.968367E-01 4.098450E-02 809 273 1.372652E+00 2.474902E-01 4.096094E-02 809 274 1.377350E+00 2.190105E-01 4.093206E-02 809 275 1.382047E+00 2.978130E-01 4.126087E-02 809 276 1.386745E+00 2.610352E-01 4.098255E-02 809 277 1.391443E+00 2.090001E-01 4.055717E-02 809 278 1.396141E+00 1.945529E-01 4.053723E-02 809 279 1.400838E+00 1.393204E-01 4.090102E-02 809 280 1.405536E+00 1.741995E-01 4.054992E-02 809 281 1.410234E+00 2.528767E-01 4.036825E-02 809 282 1.414931E+00 1.060404E-01 4.018326E-02 809 283 1.419629E+00 1.402282E-01 4.072615E-02 809 284 1.424327E+00 1.285058E-01 4.056900E-02 809 285 1.429024E+00 3.021216E-01 3.990085E-02 809 286 1.433722E+00 1.961091E-01 3.973213E-02 809 287 1.438420E+00 7.151510E-02 4.044786E-02 809 288 1.443118E+00 1.690882E-01 4.039211E-02 809 # _sas_p_of_R_details.id 809 _sas_p_of_R_details.intensity_id 809 _sas_p_of_R_details.software_p_of_R "GNOM 5.0" _sas_p_of_R_details.number_of_points 196 _sas_p_of_R_details.qmin 0.0948738 _sas_p_of_R_details.qmax 1.01093 _sas_p_of_R_details.p_of_R_point_min 1 _sas_p_of_R_details.p_of_R_point_max 196 _sas_p_of_R_details.Rmin 0.0 _sas_p_of_R_details.Rmax 25.1 # loop_ _sas_p_of_R.id _sas_p_of_R.ordinal _sas_p_of_R.r _sas_p_of_R.P _sas_p_of_R.P_error 809 1 0.000000E+00 0.000000E+00 0.000000E+00 809 2 2.261000E-01 9.387000E-03 1.934000E-04 809 3 4.523000E-01 2.186000E-02 3.283000E-04 809 4 6.784000E-01 3.737000E-02 4.077000E-04 809 5 9.045000E-01 5.585000E-02 4.370000E-04 809 6 1.131000E+00 7.720000E-02 4.233000E-04 809 7 1.357000E+00 1.013000E-01 3.766000E-04 809 8 1.583000E+00 1.279000E-01 3.109000E-04 809 9 1.809000E+00 1.570000E-01 2.493000E-04 809 10 2.035000E+00 1.883000E-01 2.292000E-04 809 11 2.261000E+00 2.216000E-01 2.726000E-04 809 12 2.487000E+00 2.567000E-01 3.544000E-04 809 13 2.714000E+00 2.932000E-01 4.437000E-04 809 14 2.940000E+00 3.311000E-01 5.232000E-04 809 15 3.166000E+00 3.700000E-01 5.837000E-04 809 16 3.392000E+00 4.097000E-01 6.198000E-04 809 17 3.618000E+00 4.499000E-01 6.293000E-04 809 18 3.844000E+00 4.904000E-01 6.124000E-04 809 19 4.070000E+00 5.309000E-01 5.720000E-04 809 20 4.296000E+00 5.711000E-01 5.138000E-04 809 21 4.523000E+00 6.109000E-01 4.479000E-04 809 22 4.749000E+00 6.500000E-01 3.898000E-04 809 23 4.975000E+00 6.881000E-01 3.613000E-04 809 24 5.201000E+00 7.252000E-01 3.784000E-04 809 25 5.427000E+00 7.609000E-01 4.364000E-04 809 26 5.653000E+00 7.951000E-01 5.156000E-04 809 27 5.879000E+00 8.277000E-01 5.983000E-04 809 28 6.105000E+00 8.584000E-01 6.726000E-04 809 29 6.332000E+00 8.872000E-01 7.310000E-04 809 30 6.558000E+00 9.139000E-01 7.694000E-04 809 31 6.784000E+00 9.384000E-01 7.863000E-04 809 32 7.010000E+00 9.606000E-01 7.826000E-04 809 33 7.236000E+00 9.804000E-01 7.613000E-04 809 34 7.462000E+00 9.977000E-01 7.281000E-04 809 35 7.688000E+00 1.013000E+00 6.905000E-04 809 36 7.914000E+00 1.025000E+00 6.578000E-04 809 37 8.141000E+00 1.035000E+00 6.395000E-04 809 38 8.367000E+00 1.042000E+00 6.417000E-04 809 39 8.593000E+00 1.046000E+00 6.649000E-04 809 40 8.819000E+00 1.048000E+00 7.040000E-04 809 41 9.045000E+00 1.047000E+00 7.506000E-04 809 42 9.271000E+00 1.044000E+00 7.964000E-04 809 43 9.497000E+00 1.039000E+00 8.348000E-04 809 44 9.723000E+00 1.031000E+00 8.618000E-04 809 45 9.950000E+00 1.020000E+00 8.756000E-04 809 46 1.018000E+01 1.008000E+00 8.771000E-04 809 47 1.040000E+01 9.936000E-01 8.696000E-04 809 48 1.063000E+01 9.772000E-01 8.581000E-04 809 49 1.085000E+01 9.591000E-01 8.493000E-04 809 50 1.108000E+01 9.394000E-01 8.496000E-04 809 51 1.131000E+01 9.183000E-01 8.639000E-04 809 52 1.153000E+01 8.959000E-01 8.939000E-04 809 53 1.176000E+01 8.725000E-01 9.373000E-04 809 54 1.198000E+01 8.481000E-01 9.893000E-04 809 55 1.221000E+01 8.232000E-01 1.044000E-03 809 56 1.244000E+01 7.977000E-01 1.094000E-03 809 57 1.266000E+01 7.719000E-01 1.136000E-03 809 58 1.289000E+01 7.459000E-01 1.167000E-03 809 59 1.312000E+01 7.199000E-01 1.184000E-03 809 60 1.334000E+01 6.941000E-01 1.188000E-03 809 61 1.357000E+01 6.686000E-01 1.182000E-03 809 62 1.379000E+01 6.436000E-01 1.169000E-03 809 63 1.402000E+01 6.190000E-01 1.155000E-03 809 64 1.425000E+01 5.950000E-01 1.145000E-03 809 65 1.447000E+01 5.717000E-01 1.144000E-03 809 66 1.470000E+01 5.490000E-01 1.156000E-03 809 67 1.492000E+01 5.271000E-01 1.182000E-03 809 68 1.515000E+01 5.059000E-01 1.219000E-03 809 69 1.538000E+01 4.855000E-01 1.265000E-03 809 70 1.560000E+01 4.657000E-01 1.314000E-03 809 71 1.583000E+01 4.466000E-01 1.362000E-03 809 72 1.605000E+01 4.280000E-01 1.405000E-03 809 73 1.628000E+01 4.101000E-01 1.441000E-03 809 74 1.651000E+01 3.926000E-01 1.468000E-03 809 75 1.673000E+01 3.756000E-01 1.485000E-03 809 76 1.696000E+01 3.590000E-01 1.493000E-03 809 77 1.719000E+01 3.427000E-01 1.493000E-03 809 78 1.741000E+01 3.267000E-01 1.488000E-03 809 79 1.764000E+01 3.110000E-01 1.478000E-03 809 80 1.786000E+01 2.954000E-01 1.467000E-03 809 81 1.809000E+01 2.801000E-01 1.456000E-03 809 82 1.832000E+01 2.650000E-01 1.446000E-03 809 83 1.854000E+01 2.501000E-01 1.438000E-03 809 84 1.877000E+01 2.354000E-01 1.434000E-03 809 85 1.899000E+01 2.210000E-01 1.435000E-03 809 86 1.922000E+01 2.069000E-01 1.442000E-03 809 87 1.945000E+01 1.931000E-01 1.456000E-03 809 88 1.967000E+01 1.797000E-01 1.477000E-03 809 89 1.990000E+01 1.668000E-01 1.507000E-03 809 90 2.013000E+01 1.544000E-01 1.544000E-03 809 91 2.035000E+01 1.426000E-01 1.588000E-03 809 92 2.058000E+01 1.313000E-01 1.637000E-03 809 93 2.080000E+01 1.208000E-01 1.688000E-03 809 94 2.103000E+01 1.109000E-01 1.739000E-03 809 95 2.126000E+01 1.016000E-01 1.789000E-03 809 96 2.148000E+01 9.312000E-02 1.836000E-03 809 97 2.171000E+01 8.529000E-02 1.879000E-03 809 98 2.193000E+01 7.810000E-02 1.920000E-03 809 99 2.216000E+01 7.153000E-02 1.959000E-03 809 100 2.239000E+01 6.551000E-02 1.998000E-03 809 101 2.261000E+01 5.995000E-02 2.035000E-03 809 102 2.284000E+01 5.478000E-02 2.069000E-03 809 103 2.306000E+01 4.989000E-02 2.095000E-03 809 104 2.329000E+01 4.517000E-02 2.105000E-03 809 105 2.352000E+01 4.050000E-02 2.089000E-03 809 106 2.374000E+01 3.578000E-02 2.035000E-03 809 107 2.397000E+01 3.088000E-02 1.926000E-03 809 108 2.420000E+01 2.568000E-02 1.747000E-03 809 109 2.442000E+01 2.009000E-02 1.481000E-03 809 110 2.465000E+01 1.400000E-02 1.112000E-03 809 111 2.487000E+01 7.323000E-03 6.229000E-04 809 112 2.510000E+01 0.000000E+00 0.000000E+00 # loop_ _sas_p_of_R_extrapolated_intensity.id _sas_p_of_R_extrapolated_intensity.ordinal _sas_p_of_R_extrapolated_intensity.momentum_transfer _sas_p_of_R_extrapolated_intensity.intensity_reg 809 1 0.000000E+00 1.520420E+02 809 2 4.517800E-03 1.519750E+02 809 3 9.035600E-03 1.517780E+02 809 4 1.355340E-02 1.514490E+02 809 5 1.807120E-02 1.509900E+02 809 6 2.258900E-02 1.504020E+02 809 7 2.710680E-02 1.496860E+02 809 8 3.162460E-02 1.488450E+02 809 9 3.614240E-02 1.478810E+02 809 10 4.066020E-02 1.467950E+02 809 11 4.517800E-02 1.455920E+02 809 12 4.969580E-02 1.442740E+02 809 13 5.421360E-02 1.428440E+02 809 14 5.873140E-02 1.413070E+02 809 15 6.324920E-02 1.396650E+02 809 16 6.776700E-02 1.379240E+02 809 17 7.228480E-02 1.360880E+02 809 18 7.680260E-02 1.341610E+02 809 19 8.132040E-02 1.321480E+02 809 20 8.583820E-02 1.300540E+02 809 21 9.035600E-02 1.278830E+02 809 22 9.487380E-02 1.256420E+02 809 23 9.957150E-02 1.232430E+02 809 24 1.042690E-01 1.207780E+02 809 25 1.089670E-01 1.182550E+02 809 26 1.136650E-01 1.156790E+02 809 27 1.183620E-01 1.130560E+02 809 28 1.230600E-01 1.103930E+02 809 29 1.277580E-01 1.076960E+02 809 30 1.324560E-01 1.049710E+02 809 31 1.371530E-01 1.022240E+02 809 32 1.418510E-01 9.946050E+01 809 33 1.465490E-01 9.668670E+01 809 34 1.512460E-01 9.390820E+01 809 35 1.559440E-01 9.113050E+01 809 36 1.606420E-01 8.835890E+01 809 37 1.653400E-01 8.559860E+01 809 38 1.700370E-01 8.285450E+01 809 39 1.747350E-01 8.013130E+01 809 40 1.794330E-01 7.743360E+01 809 41 1.841300E-01 7.476570E+01 809 42 1.888280E-01 7.213160E+01 809 43 1.935260E-01 6.953500E+01 809 44 1.982230E-01 6.697950E+01 809 45 2.029210E-01 6.446820E+01 809 46 2.076190E-01 6.200430E+01 809 47 2.123170E-01 5.959030E+01 809 48 2.170140E-01 5.722880E+01 809 49 2.217120E-01 5.492190E+01 809 50 2.264100E-01 5.267150E+01 809 51 2.311070E-01 5.047930E+01 809 52 2.358050E-01 4.834670E+01 809 53 2.405030E-01 4.627480E+01 809 54 2.452010E-01 4.426440E+01 809 55 2.498980E-01 4.231630E+01 809 56 2.545960E-01 4.043080E+01 809 57 2.592940E-01 3.860820E+01 809 58 2.639910E-01 3.684850E+01 809 59 2.686890E-01 3.515150E+01 809 60 2.733870E-01 3.351680E+01 809 61 2.780850E-01 3.194370E+01 809 62 2.827820E-01 3.043170E+01 809 63 2.874800E-01 2.897990E+01 809 64 2.921780E-01 2.758720E+01 809 65 2.968760E-01 2.625250E+01 809 66 3.015730E-01 2.497460E+01 809 67 3.062710E-01 2.375210E+01 809 68 3.109690E-01 2.258360E+01 809 69 3.156660E-01 2.146760E+01 809 70 3.203640E-01 2.040260E+01 809 71 3.250620E-01 1.938690E+01 809 72 3.297590E-01 1.841890E+01 809 73 3.344570E-01 1.749690E+01 809 74 3.391550E-01 1.661930E+01 809 75 3.438530E-01 1.578420E+01 809 76 3.485500E-01 1.499000E+01 809 77 3.532480E-01 1.423510E+01 809 78 3.579460E-01 1.351760E+01 809 79 3.626440E-01 1.283600E+01 809 80 3.673410E-01 1.218860E+01 809 81 3.720390E-01 1.157390E+01 809 82 3.767370E-01 1.099030E+01 809 83 3.814340E-01 1.043630E+01 809 84 3.861320E-01 9.910330E+00 809 85 3.908300E-01 9.411130E+00 809 86 3.955270E-01 8.937300E+00 809 87 4.002250E-01 8.487550E+00 809 88 4.049230E-01 8.060630E+00 809 89 4.096210E-01 7.655360E+00 809 90 4.143180E-01 7.270630E+00 809 91 4.190160E-01 6.905370E+00 809 92 4.237140E-01 6.558570E+00 809 93 4.284120E-01 6.229290E+00 809 94 4.331090E-01 5.916650E+00 809 95 4.378070E-01 5.619790E+00 809 96 4.425050E-01 5.337950E+00 809 97 4.472020E-01 5.070360E+00 809 98 4.519000E-01 4.816340E+00 809 99 4.565980E-01 4.575260E+00 809 100 4.612960E-01 4.346510E+00 809 101 4.659930E-01 4.129520E+00 809 102 4.706910E-01 3.923770E+00 809 103 4.753890E-01 3.728750E+00 809 104 4.800860E-01 3.544030E+00 809 105 4.847840E-01 3.369140E+00 809 106 4.894820E-01 3.203690E+00 809 107 4.941790E-01 3.047290E+00 809 108 4.988770E-01 2.899560E+00 809 109 5.035750E-01 2.760180E+00 809 110 5.082730E-01 2.628810E+00 809 111 5.129700E-01 2.505090E+00 809 112 5.176680E-01 2.388760E+00 809 113 5.223660E-01 2.279510E+00 809 114 5.270640E-01 2.177050E+00 809 115 5.317610E-01 2.081070E+00 809 116 5.364590E-01 1.991380E+00 809 117 5.411570E-01 1.907640E+00 809 118 5.458540E-01 1.829590E+00 809 119 5.505520E-01 1.756990E+00 809 120 5.552500E-01 1.689570E+00 809 121 5.599470E-01 1.627090E+00 809 122 5.646450E-01 1.569280E+00 809 123 5.693430E-01 1.515900E+00 809 124 5.740410E-01 1.466770E+00 809 125 5.787380E-01 1.421470E+00 809 126 5.834360E-01 1.379930E+00 809 127 5.881340E-01 1.341860E+00 809 128 5.928310E-01 1.307030E+00 809 129 5.975290E-01 1.275210E+00 809 130 6.022270E-01 1.246190E+00 809 131 6.069250E-01 1.219740E+00 809 132 6.116220E-01 1.195670E+00 809 133 6.163200E-01 1.173760E+00 809 134 6.210180E-01 1.153830E+00 809 135 6.257150E-01 1.135680E+00 809 136 6.304130E-01 1.119130E+00 809 137 6.351110E-01 1.104020E+00 809 138 6.398090E-01 1.090180E+00 809 139 6.445060E-01 1.077460E+00 809 140 6.492040E-01 1.065710E+00 809 141 6.539020E-01 1.054800E+00 809 142 6.585990E-01 1.044610E+00 809 143 6.632970E-01 1.034980E+00 809 144 6.679950E-01 1.025930E+00 809 145 6.726930E-01 1.017230E+00 809 146 6.773900E-01 1.008850E+00 809 147 6.820880E-01 1.000700E+00 809 148 6.867860E-01 9.927210E-01 809 149 6.914830E-01 9.848480E-01 809 150 6.961810E-01 9.770270E-01 809 151 7.008790E-01 9.692190E-01 809 152 7.055770E-01 9.613810E-01 809 153 7.102740E-01 9.534880E-01 809 154 7.149720E-01 9.455130E-01 809 155 7.196700E-01 9.374380E-01 809 156 7.243670E-01 9.292490E-01 809 157 7.290650E-01 9.209390E-01 809 158 7.337630E-01 9.125000E-01 809 159 7.384610E-01 9.039360E-01 809 160 7.431580E-01 8.952470E-01 809 161 7.478560E-01 8.864330E-01 809 162 7.525540E-01 8.775190E-01 809 163 7.572510E-01 8.684720E-01 809 164 7.619490E-01 8.593410E-01 809 165 7.666470E-01 8.501200E-01 809 166 7.713450E-01 8.408250E-01 809 167 7.760420E-01 8.314600E-01 809 168 7.807400E-01 8.220370E-01 809 169 7.854380E-01 8.125720E-01 809 170 7.901350E-01 8.030670E-01 809 171 7.948330E-01 7.935750E-01 809 172 7.995310E-01 7.839750E-01 809 173 8.042290E-01 7.744040E-01 809 174 8.089260E-01 7.648230E-01 809 175 8.136240E-01 7.552390E-01 809 176 8.183220E-01 7.456520E-01 809 177 8.230190E-01 7.360720E-01 809 178 8.277170E-01 7.264960E-01 809 179 8.324150E-01 7.169270E-01 809 180 8.371130E-01 7.073660E-01 809 181 8.418100E-01 6.977890E-01 809 182 8.465080E-01 6.882740E-01 809 183 8.512060E-01 6.787440E-01 809 184 8.559040E-01 6.692250E-01 809 185 8.606010E-01 6.597190E-01 809 186 8.652990E-01 6.502270E-01 809 187 8.699960E-01 6.407510E-01 809 188 8.746940E-01 6.312930E-01 809 189 8.793920E-01 6.218560E-01 809 190 8.840900E-01 6.124380E-01 809 191 8.887870E-01 6.030670E-01 809 192 8.934850E-01 5.937240E-01 809 193 8.981830E-01 5.844260E-01 809 194 9.028810E-01 5.751800E-01 809 195 9.075780E-01 5.659940E-01 809 196 9.122760E-01 5.568850E-01 809 197 9.169740E-01 5.478560E-01 809 198 9.216710E-01 5.389220E-01 809 199 9.263690E-01 5.300950E-01 809 200 9.310670E-01 5.213910E-01 809 201 9.357650E-01 5.128210E-01 809 202 9.404620E-01 5.044020E-01 809 203 9.451600E-01 4.961450E-01 809 204 9.498580E-01 4.880620E-01 809 205 9.545550E-01 4.801820E-01 809 206 9.592530E-01 4.725040E-01 809 207 9.639510E-01 4.650450E-01 809 208 9.686490E-01 4.578200E-01 809 209 9.733460E-01 4.508350E-01 809 210 9.780440E-01 4.441150E-01 809 211 9.827420E-01 4.376560E-01 809 212 9.874390E-01 4.314710E-01 809 213 9.921370E-01 4.255660E-01 809 214 9.968350E-01 4.199480E-01 809 215 1.001530E+00 4.146180E-01 809 216 1.006230E+00 4.095810E-01 809 217 1.010930E+00 4.048330E-01 #