{
"code": "SASDEA9",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Calcium sensing via EF-hand 4 enables thioredoxin activity in the sensor-responder protein calredoxin in the green alga Chlamydomonas reinhardtii.",
"publication": {
"title": "Calcium sensing via EF-hand 4 enables thioredoxin activity in the sensor-responder protein calredoxin in the green alga Chlamydomonas reinhardtii.",
"author_list": "Charoenwattanasatien R, Zinzius K, Scholz M, Wicke S, Tanaka H, Brandenburg JS, Marchetti GM, Ikegami T, Matsumoto T, Oda T, Sato M, Hippler M, Kurisu G",
"journal": "J Biol Chem",
"doi": "10.1074/jbc.RA119.008735",
"pmid": "31776187",
"published_date": "2019 Nov 27"
},
"status": "released",
"submitted_date": "2018-12-27",
"released_date": "2019-12-17"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDEA9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDEA9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEA9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEA9_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDEA9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEA9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEA9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 100K",
"resolution": 172.0
},
"name": "Structural Biology Laboratory, Graduate School of Medical Life Science, Yokohama City University",
"city": "Yokohama",
"country": "Japan",
"beamline_name": "Rigaku BioSAXS-1000",
"beam_geometry": null,
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Calredoxin, Redox protein from Chlamydomonas reinhardtii",
"short_name": "CRX",
"sequence": "MCSARSVRVVPRAATFEGLMDDASKAKMEELERRFKMADVDGNGHIDREELRNLLESMESGEVYMMSQHWLPEDELERCMEQYDVNKDGVISFEEFKQIIYDGLLLEGTLAEYESAFKAVDKSGNGTIGATELSKLFASLGNPVSLEKLVDLMQMYDKDDSGQIEFPEFLLMFRNSLLDLKDMTTYMTLDEAGAGSSGSLVDAVEGDMTLIFSEEELDALISANPDKLVVVFGALTWCRPCKGMQRPVQKLAEHYKDHIVFVKLFGNANKQTKRIFKERFQIRSTPCFITLRKGEPVYTQTGSNKEKLEAGLRSLIANPPVGMIYPSAEALAALQDPNSSSVDKLAAALEHHHHHH",
"organism": "Chlamydomonas reinhardtii",
"uniprot_code": "A0A2K3DZB3",
"uniprot_range_first": 25,
"uniprot_range_last": 357,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MIAIRTAHMLSGAQRAGSGTRVPRCSARSVRVVPRAATFEGLMDDASKAKMEELERRFKM\nADVDGNGHIDREELRNLLESMESGEVYMMSQHWLPEDELERCMEQYDVNKDGVISFEEFK\nQIIYDGLLLEGTLAEYESAFKAVDKSGNGTIGATELSKLFASLGNPVSLEKLVDLMQMYD\nKDDSGQIEFPEFLLMFRNSLLDLKDMTTYMTLDEAGAGSSGSLVDAVEGDMTLIFSEEEL\nDALISANPDKLVVVFGALTWCRPCKGMQRPVQKLAEHYKDHIVFVKLFGNANKQTKRIFK\nERFQIRSTPCFITLRKGEPVYTQTGSNKEKLEAGLRSLIANPPVGMIYPSAEALAAL",
"mw": 39.901,
"total_mw": 39.901,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Tris, 150 mM NaCl, 1 mM DTT, 5 mM CaCl2",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Calredoxin with Calcium",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Thailand",
"full_name": "Synchrotron Light Research Institute",
"webpage": "https://www.slri.or.th"
}
],
"contributor_name": "Ratana",
"contributor_surname": "Charoenwattanasatien",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-11-17",
"storage_temperature": null,
"cell_temperature": 20.0,
"exposure_time": 120.0,
"number_of_frames": 2,
"wavelength": 0.15418,
"sample_detector_distance": null,
"concentration_min": null,
"concentration_max": 5.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.033,
"s_max": 6.681,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SAXS data from solutions of Calredoxin with Calcium in 20 mM Tris, 150 mM NaCl, 1 mM DTT, 5 mM CaCl2, pH 8 were collected on a Rigaku BioSAXS-1000 instrument at the Structural Biology Laboratory, Graduate School of Medical Life Science, Yokohama City University (Yokohama, Japan) using a Pilatus 100K detector at a wavelength of λ = 0.15418 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 5.00 mg/ml was measured at 20°C. Two successive 120 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 42.05,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 42.0,
"porod_mw_error": null,
"pddf_i0": 0.7076,
"pddf_i0_error": null,
"guinier_i0": 0.7,
"guinier_i0_error": 0.003,
"pddf_rg": 3.19,
"pddf_rg_error": null,
"guinier_rg": 3.06,
"guinier_rg_error": 0.08,
"pddf_dmax": 11.56,
"pddf_dmax_error": null,
"porod_volume": 68.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 16,
"guinier_point_last": 58,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDEA9_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-17T19:23:05.878669+01:00",
"bragg_peak": []
}