data_SASDCB9_MAIN # _sas_result.id 746 _sas_result.SASBDB_code SASDCB9 _sas_result.experimental_MW 148.000 _sas_result.experimental_MW_error . _sas_result.MW_standard . _sas_result.MW_standard_error . _sas_result.MW_Porod . _sas_result.MW_Porod_error . _sas_result.I0_from_PR 0.0467000000 _sas_result.I0_from_PR_error 0.0013000000 _sas_result.I0_from_Guinier 0.0480000000 _sas_result.I0_from_Guinier_error 0.0022000000 _sas_result.Rg_from_PR 4.227 _sas_result.Rg_from_PR_error 0.069 _sas_result.Rg_from_Guinier 4.324 _sas_result.Rg_from_Guinier_error 0.767 _sas_result.D_max 10.70 _sas_result.Porod_volume . _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min 4 _sas_result.Guinier_point_max 22 _sas_result.type_of_curve single_conc _sas_result.standard . _sas_result.Dmax_error . _sas_result.comments "Additional SANS measurement parameters. Three detector positions (in m) and count times (s) were employed: 1 m (two frames of 600 + 600 = 1200 s total count time); 4 m (two frames of 1800 + 1800 = 3600 s total count time); 13 m (two frames of 600 + 600 = 1200 s total count time)." # _sas_scan.title "Nanolipoprotein Particle (NLP) assembled with tail-deuterated DMPC - 100% D2O SANS" _sas_scan.detc_id 43 _sas_scan.id 746 _sas_scan.measurement_date 2016-04-11 _sas_scan.storage_temperature 4.0 _sas_scan.cell_temperature 20.0 _sas_scan.exposure_time 1800.000 _sas_scan.number_of_frames 2 _sas_scan.unit 1/A _sas_scan.qmin 0.0078 _sas_scan.qmax 0.5936 _sas_scan.sample_id 706 _sas_scan.result_id 746 _sas_scan.beam_id 64 # _sas_beam.id 64 _sas_beam.instrument_name "NIST Center for Neutron Research NG7" _sas_beam.instrument_city "Gaithersburg, MD" _sas_beam.instrument_country USA _sas_beam.shape . _sas_beam.type_of_source "neutron source" _sas_beam.radiation_wavelength 0.600000 _sas_beam.dist_spec_to_detc 4.00000 # _sas_detc.id 43 _sas_detc.name "Ordela 2660N" _sas_detc.type "640x640 mm 3He posn sensitive prop counter" _sas_detc.pixsize_x 5.080 # _sas_sample.id 706 _sas_sample.name "Nanolipoprotein Particle (NLP) assembled with tail-deuterated DMPC - 100% D2O SANS" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration 0.88 _sas_sample.concentration_method . loop_ _sas_sample.entity_id 861 865 # _sas_buffer.id 428 _sas_buffer.name "PBS in D2O" _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.400 _sas_buffer.comment "8 g/L NaCl, 0.2 g/L KH2PO4, 1.15 g/L Na2HPO4, 0.2 g/L KCl, in D2O with no additional pH adjustment" _sas_buffer.composition . _sas_buffer.sample_id 706 # loop_ _entity.id _entity.type _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules 861 protein "Apolipoprotein A-I" 25.153 2 865 other 1,2-dimyristoyl-d54-sn-glycero-3-phosphocholine 0.732 . # loop_ _entity_name_com.entity_id _entity_name_com.name 861 ApoA-I 865 d54-DMPC # loop_ _entity_poly.entity_id _entity_poly.pdbx_seq_one_letter_code 861 MHHHHHHGENLYFQGMLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTKAQSVIDKASETLTAQ 865 N/A # loop_ _entity_src_gen.entity_id _entity_src_gen.gene_src_common_name 861 "Mus musculus" 865 . # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code 1 861 UniProt Q00623 2 865 UniProt . _struct_ref.details http://www.uniprot.org/uniprot/Q00623 # _citation.id 305 _citation.title "Small-angle X-ray and neutron scattering demonstrates that cell-free expression produces properly formed disc-shaped nanolipoprotein particles." _citation.year "2017 Dec 20" _citation.pdbx_database_id_DOI 10.1002/pro.3365 _citation.pdbx_database_id_PubMed 29266475 # loop_ _citation_author.citation_id _citation_author.ordinal _citation_author.name 305 1 "Cleveland TE 4th" 305 2 "He W" 305 3 "Evans AC" 305 4 "Fischer NO" 305 5 "Lau EY" 305 6 "Coleman MA" # _pdbx_contact_author.id 197 _pdbx_contact_author.name_first Thomas _pdbx_contact_author.name_last Cleveland _pdbx_contact_author.role . _pdbx_contact_author.address_1 . _pdbx_contact_author.address_2 "National Institute of Standards and Technology, Gaithersburg, MD, USA" _pdbx_contact_author.address_3 . # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 7.775000E-03 4.042790E-02 1.763000E-02 746 2 9.413000E-03 4.412790E-02 1.375000E-02 746 3 1.104000E-02 3.522790E-02 1.247000E-02 746 4 1.268000E-02 4.592790E-02 1.057000E-02 746 5 1.396000E-02 4.362790E-02 3.936000E-03 746 6 1.433000E-02 4.652790E-02 1.016000E-02 746 7 1.529000E-02 3.992790E-02 3.491000E-03 746 8 1.595000E-02 4.092790E-02 9.000000E-03 746 9 1.662000E-02 4.332790E-02 3.420000E-03 746 10 1.760000E-02 3.872790E-02 8.507000E-03 746 11 1.795000E-02 4.212790E-02 3.468000E-03 746 12 1.923000E-02 3.622790E-02 8.233000E-03 746 13 1.928000E-02 3.612790E-02 3.229000E-03 746 14 2.061000E-02 3.342790E-02 2.788000E-03 746 15 2.087000E-02 3.392790E-02 7.583000E-03 746 16 2.194000E-02 3.852790E-02 2.856000E-03 746 17 2.327000E-02 3.172790E-02 2.648000E-03 746 18 2.460000E-02 3.322790E-02 2.677000E-03 746 19 2.593000E-02 2.822790E-02 2.387000E-03 746 20 2.726000E-02 3.352790E-02 2.592000E-03 746 21 2.859000E-02 2.452790E-02 2.672000E-03 746 22 2.991000E-02 3.042790E-02 2.481000E-03 746 23 3.124000E-02 2.582790E-02 2.607000E-03 746 24 3.257000E-02 2.099790E-02 2.113000E-03 746 25 3.390000E-02 2.222790E-02 2.221000E-03 746 26 3.523000E-02 2.112790E-02 2.198000E-03 746 27 3.656000E-02 2.292790E-02 2.233000E-03 746 28 3.788000E-02 2.332790E-02 2.077000E-03 746 29 3.921000E-02 2.012790E-02 2.154000E-03 746 30 4.054000E-02 1.633790E-02 2.076000E-03 746 31 4.187000E-02 1.622790E-02 1.936000E-03 746 32 4.320000E-02 1.549790E-02 1.961000E-03 746 33 4.452000E-02 1.719790E-02 1.799000E-03 746 34 4.585000E-02 1.294790E-02 1.833000E-03 746 35 4.718000E-02 1.079790E-02 1.895000E-03 746 36 4.850000E-02 1.385790E-02 1.871000E-03 746 37 4.983000E-02 1.014790E-02 1.932000E-03 746 38 5.049000E-02 8.227890E-03 8.113000E-04 746 39 5.116000E-02 8.737890E-03 1.773000E-03 746 40 5.248000E-02 6.427890E-03 1.721000E-03 746 41 5.381000E-02 7.787890E-03 1.663000E-03 746 42 5.514000E-02 8.777890E-03 1.704000E-03 746 43 5.580000E-02 6.967890E-03 7.962000E-04 746 44 5.646000E-02 6.727890E-03 1.678000E-03 746 45 5.779000E-02 5.567890E-03 1.620000E-03 746 46 5.911000E-02 7.397890E-03 1.565000E-03 746 47 6.044000E-02 5.287890E-03 1.511000E-03 746 48 6.110000E-02 5.537890E-03 8.569000E-04 746 49 6.176000E-02 3.957890E-03 1.537000E-03 746 50 6.309000E-02 4.887890E-03 1.463000E-03 746 51 6.640000E-02 3.767890E-03 7.908000E-04 746 52 7.169000E-02 3.247890E-03 7.432000E-04 746 53 7.698000E-02 4.207890E-03 7.899000E-04 746 54 8.227000E-02 4.487890E-03 7.359000E-04 746 55 8.755000E-02 4.427890E-03 6.473000E-04 746 56 9.282000E-02 3.097890E-03 8.168000E-04 746 57 9.809000E-02 4.177890E-03 7.712000E-04 746 58 1.034000E-01 4.297890E-03 6.690000E-04 746 59 1.086000E-01 3.737890E-03 6.467000E-04 746 60 1.139000E-01 4.727890E-03 7.203000E-04 746 61 1.191000E-01 3.307890E-03 7.098000E-04 746 62 1.244000E-01 5.027890E-03 5.799000E-04 746 63 1.296000E-01 3.667890E-03 6.106000E-04 746 64 1.348000E-01 3.637890E-03 5.765000E-04 746 65 1.400000E-01 3.757890E-03 5.824000E-04 746 66 1.452000E-01 3.037890E-03 6.093000E-04 746 67 1.504000E-01 3.147890E-03 5.059000E-04 746 68 1.556000E-01 2.647890E-03 5.914000E-04 746 69 1.608000E-01 2.517890E-03 5.654000E-04 746 70 1.660000E-01 2.997890E-03 6.446000E-04 746 71 1.712000E-01 3.347890E-03 5.195000E-04 746 72 1.763000E-01 3.077890E-03 5.585000E-04 746 73 1.815000E-01 2.017890E-03 5.422000E-04 746 74 1.866000E-01 2.727890E-03 5.365000E-04 746 75 1.917000E-01 3.107890E-03 5.235000E-04 746 76 1.968000E-01 2.247890E-03 5.200000E-04 746 77 2.019000E-01 3.107890E-03 6.046000E-04 746 78 2.070000E-01 1.977890E-03 5.553000E-04 746 79 2.121000E-01 2.817890E-03 5.274000E-04 746 80 2.172000E-01 1.937890E-03 5.067000E-04 746 81 2.223000E-01 2.397890E-03 5.242000E-04 746 82 2.273000E-01 1.897890E-03 5.139000E-04 746 83 2.323000E-01 2.097890E-03 4.809000E-04 746 84 2.374000E-01 2.397890E-03 5.449000E-04 746 85 2.424000E-01 1.887890E-03 5.092000E-04 746 86 2.474000E-01 1.957890E-03 4.795000E-04 746 87 2.524000E-01 2.067890E-03 4.864000E-04 746 88 2.573000E-01 2.387890E-03 4.796000E-04 746 89 2.623000E-01 2.467890E-03 5.124000E-04 746 90 2.672000E-01 1.197890E-03 4.732000E-04 746 91 2.722000E-01 2.257890E-03 4.540000E-04 746 92 2.771000E-01 2.117890E-03 4.694000E-04 746 93 2.820000E-01 2.147890E-03 4.749000E-04 746 94 2.869000E-01 1.927890E-03 4.698000E-04 746 95 2.917000E-01 8.978950E-04 4.641000E-04 746 96 2.966000E-01 1.407890E-03 4.786000E-04 746 97 3.015000E-01 8.478950E-04 4.549000E-04 746 98 3.063000E-01 8.778950E-04 4.119000E-04 746 99 3.111000E-01 1.017890E-03 4.445000E-04 746 100 3.159000E-01 1.467890E-03 4.622000E-04 746 101 3.207000E-01 2.247890E-03 4.901000E-04 746 102 3.254000E-01 1.517890E-03 5.388000E-04 746 103 3.302000E-01 1.317890E-03 5.361000E-04 746 104 3.349000E-01 1.177890E-03 5.165000E-04 746 105 3.397000E-01 2.517890E-03 5.519000E-04 746 106 3.444000E-01 1.607890E-03 5.250000E-04 746 107 3.490000E-01 5.878950E-04 5.505000E-04 746 108 3.537000E-01 2.878950E-04 5.402000E-04 746 109 3.584000E-01 7.894740E-06 5.395000E-04 746 110 3.630000E-01 1.397890E-03 6.051000E-04 746 111 3.676000E-01 1.257890E-03 5.814000E-04 746 112 3.722000E-01 1.567890E-03 5.708000E-04 746 113 3.768000E-01 2.077890E-03 5.841000E-04 746 114 3.814000E-01 1.257890E-03 5.609000E-04 746 115 3.859000E-01 1.347890E-03 4.886000E-04 746 116 3.905000E-01 1.127890E-03 5.738000E-04 746 117 3.950000E-01 7.178950E-04 5.474000E-04 746 118 3.995000E-01 2.057890E-03 5.746000E-04 746 119 4.040000E-01 6.378950E-04 5.234000E-04 746 120 4.084000E-01 4.578950E-04 6.262000E-04 746 121 4.129000E-01 5.878950E-04 6.092000E-04 746 122 4.173000E-01 7.678950E-04 5.404000E-04 746 123 4.217000E-01 8.178950E-04 5.683000E-04 746 124 4.261000E-01 5.178950E-04 5.180000E-04 746 125 4.305000E-01 8.278950E-04 6.081000E-04 746 126 4.348000E-01 1.177890E-03 5.917000E-04 746 127 4.392000E-01 1.017890E-03 5.705000E-04 746 128 4.435000E-01 1.077890E-03 5.841000E-04 746 129 4.478000E-01 1.017890E-03 5.983000E-04 746 130 4.521000E-01 1.177890E-03 6.299000E-04 746 131 4.563000E-01 9.678950E-04 6.047000E-04 746 132 4.606000E-01 1.197890E-03 5.550000E-04 746 133 4.648000E-01 1.878950E-04 5.461000E-04 746 134 4.690000E-01 -2.321050E-04 5.790000E-04 746 135 4.732000E-01 9.278950E-04 5.160000E-04 746 136 4.774000E-01 -2.121050E-04 5.971000E-04 746 137 4.815000E-01 -2.210530E-05 6.508000E-04 746 138 4.856000E-01 -8.021050E-04 6.381000E-04 746 139 4.897000E-01 8.789470E-05 6.366000E-04 746 140 4.938000E-01 9.778950E-04 6.014000E-04 746 141 4.979000E-01 1.878950E-04 5.584000E-04 746 142 5.020000E-01 4.778950E-04 5.780000E-04 746 143 5.060000E-01 -4.321050E-04 6.532000E-04 746 144 5.100000E-01 -9.421050E-04 6.562000E-04 746 145 5.140000E-01 -3.121050E-04 7.157000E-04 746 146 5.180000E-01 -1.121050E-04 6.961000E-04 746 147 5.220000E-01 8.278950E-04 6.331000E-04 746 148 5.259000E-01 2.378950E-04 5.739000E-04 746 149 5.298000E-01 -9.621050E-04 6.105000E-04 746 150 5.337000E-01 3.478950E-04 6.187000E-04 746 151 5.376000E-01 -2.321050E-04 7.581000E-04 746 152 5.415000E-01 -1.921050E-04 7.294000E-04 746 153 5.453000E-01 -1.322110E-03 8.729000E-04 746 154 5.492000E-01 -9.621050E-04 7.964000E-04 746 155 5.530000E-01 -1.332110E-03 9.169000E-04 746 156 5.568000E-01 2.178950E-04 9.655000E-04 746 157 5.605000E-01 5.778950E-04 9.140000E-04 746 158 5.643000E-01 -1.472110E-03 1.015000E-03 746 159 5.680000E-01 -3.121050E-04 1.353000E-03 746 160 5.717000E-01 -3.921050E-04 1.460000E-03 746 161 5.754000E-01 -2.021050E-04 1.317000E-03 746 162 5.791000E-01 1.357890E-03 1.468000E-03 746 163 5.828000E-01 -2.052110E-03 2.006000E-03 746 164 5.864000E-01 -2.242110E-03 1.694000E-03 746 165 5.900000E-01 -2.352110E-03 2.327000E-03 746 166 5.936000E-01 7.847890E-03 9.762000E-01 746 # _sas_p_of_R_details.id 746 _sas_p_of_R_details.intensity_id 746 _sas_p_of_R_details.software_p_of_R "GNOM 5.0" _sas_p_of_R_details.number_of_points 70 _sas_p_of_R_details.qmin 0.01268 _sas_p_of_R_details.qmax 0.1815 _sas_p_of_R_details.p_of_R_point_min 1 _sas_p_of_R_details.p_of_R_point_max 70 _sas_p_of_R_details.Rmin 0.0 _sas_p_of_R_details.Rmax 107.1 # loop_ _sas_p_of_R.id _sas_p_of_R.ordinal _sas_p_of_R.r _sas_p_of_R.P _sas_p_of_R.P_error 746 1 0.000000E+00 0.000000E+00 0.000000E+00 746 2 1.647000E+00 9.738000E-06 7.559000E-07 746 3 3.294000E+00 1.751000E-05 1.236000E-06 746 4 4.941000E+00 2.339000E-05 1.465000E-06 746 5 6.588000E+00 2.753000E-05 1.483000E-06 746 6 8.235000E+00 3.008000E-05 1.351000E-06 746 7 9.882000E+00 3.127000E-05 1.161000E-06 746 8 1.153000E+01 3.134000E-05 1.053000E-06 746 9 1.318000E+01 3.053000E-05 1.154000E-06 746 10 1.482000E+01 2.911000E-05 1.433000E-06 746 11 1.647000E+01 2.733000E-05 1.772000E-06 746 12 1.812000E+01 2.543000E-05 2.079000E-06 746 13 1.976000E+01 2.361000E-05 2.305000E-06 746 14 2.141000E+01 2.206000E-05 2.427000E-06 746 15 2.306000E+01 2.091000E-05 2.439000E-06 746 16 2.471000E+01 2.028000E-05 2.355000E-06 746 17 2.635000E+01 2.022000E-05 2.207000E-06 746 18 2.800000E+01 2.076000E-05 2.045000E-06 746 19 2.965000E+01 2.188000E-05 1.932000E-06 746 20 3.129000E+01 2.353000E-05 1.928000E-06 746 21 3.294000E+01 2.566000E-05 2.050000E-06 746 22 3.459000E+01 2.816000E-05 2.267000E-06 746 23 3.624000E+01 3.095000E-05 2.525000E-06 746 24 3.788000E+01 3.391000E-05 2.776000E-06 746 25 3.953000E+01 3.696000E-05 2.989000E-06 746 26 4.118000E+01 3.999000E-05 3.150000E-06 746 27 4.282000E+01 4.293000E-05 3.257000E-06 746 28 4.447000E+01 4.571000E-05 3.320000E-06 746 29 4.612000E+01 4.828000E-05 3.357000E-06 746 30 4.777000E+01 5.060000E-05 3.387000E-06 746 31 4.941000E+01 5.265000E-05 3.428000E-06 746 32 5.106000E+01 5.443000E-05 3.490000E-06 746 33 5.271000E+01 5.593000E-05 3.575000E-06 746 34 5.435000E+01 5.716000E-05 3.677000E-06 746 35 5.600000E+01 5.814000E-05 3.785000E-06 746 36 5.765000E+01 5.887000E-05 3.889000E-06 746 37 5.929000E+01 5.936000E-05 3.980000E-06 746 38 6.094000E+01 5.962000E-05 4.054000E-06 746 39 6.259000E+01 5.964000E-05 4.113000E-06 746 40 6.424000E+01 5.943000E-05 4.161000E-06 746 41 6.588000E+01 5.897000E-05 4.204000E-06 746 42 6.753000E+01 5.825000E-05 4.248000E-06 746 43 6.918000E+01 5.727000E-05 4.297000E-06 746 44 7.082000E+01 5.601000E-05 4.353000E-06 746 45 7.247000E+01 5.446000E-05 4.413000E-06 746 46 7.412000E+01 5.264000E-05 4.476000E-06 746 47 7.577000E+01 5.056000E-05 4.537000E-06 746 48 7.741000E+01 4.822000E-05 4.593000E-06 746 49 7.906000E+01 4.567000E-05 4.641000E-06 746 50 8.071000E+01 4.295000E-05 4.681000E-06 746 51 8.235000E+01 4.009000E-05 4.712000E-06 746 52 8.400000E+01 3.715000E-05 4.738000E-06 746 53 8.565000E+01 3.418000E-05 4.759000E-06 746 54 8.730000E+01 3.123000E-05 4.778000E-06 746 55 8.894000E+01 2.833000E-05 4.792000E-06 746 56 9.059000E+01 2.553000E-05 4.797000E-06 746 57 9.224000E+01 2.285000E-05 4.786000E-06 746 58 9.388000E+01 2.028000E-05 4.743000E-06 746 59 9.553000E+01 1.782000E-05 4.648000E-06 746 60 9.718000E+01 1.545000E-05 4.474000E-06 746 61 9.882000E+01 1.312000E-05 4.190000E-06 746 62 1.005000E+02 1.078000E-05 3.764000E-06 746 63 1.021000E+02 8.366000E-06 3.161000E-06 746 64 1.038000E+02 5.809000E-06 2.350000E-06 746 65 1.054000E+02 3.042000E-06 1.304000E-06 746 66 1.071000E+02 0.000000E+00 0.000000E+00 # loop_ _sas_p_of_R_extrapolated_intensity.id _sas_p_of_R_extrapolated_intensity.ordinal _sas_p_of_R_extrapolated_intensity.momentum_transfer _sas_p_of_R_extrapolated_intensity.intensity_reg 746 1 0.000000E+00 4.665090E-02 746 2 1.268000E-03 4.660630E-02 746 3 2.536000E-03 4.647250E-02 746 4 3.804000E-03 4.625050E-02 746 5 5.072000E-03 4.594120E-02 746 6 6.340000E-03 4.554630E-02 746 7 7.608000E-03 4.506790E-02 746 8 8.876000E-03 4.450850E-02 746 9 1.014400E-02 4.387100E-02 746 10 1.141200E-02 4.315860E-02 746 11 1.268000E-02 4.237500E-02 746 12 1.396000E-02 4.151590E-02 746 13 1.433000E-02 4.125540E-02 746 14 1.529000E-02 4.055540E-02 746 15 1.595000E-02 4.005470E-02 746 16 1.662000E-02 3.953100E-02 746 17 1.760000E-02 3.873860E-02 746 18 1.795000E-02 3.844830E-02 746 19 1.923000E-02 3.735670E-02 746 20 1.928000E-02 3.731310E-02 746 21 2.061000E-02 3.613150E-02 746 22 2.087000E-02 3.589560E-02 746 23 2.194000E-02 3.490950E-02 746 24 2.327000E-02 3.365360E-02 746 25 2.460000E-02 3.236990E-02 746 26 2.593000E-02 3.106500E-02 746 27 2.726000E-02 2.974520E-02 746 28 2.859000E-02 2.841660E-02 746 29 2.991000E-02 2.709550E-02 746 30 3.124000E-02 2.576770E-02 746 31 3.257000E-02 2.444910E-02 746 32 3.390000E-02 2.314520E-02 746 33 3.523000E-02 2.186120E-02 746 34 3.656000E-02 2.060210E-02 746 35 3.788000E-02 1.938170E-02 746 36 3.921000E-02 1.818570E-02 746 37 4.054000E-02 1.702740E-02 746 38 4.187000E-02 1.591030E-02 746 39 4.320000E-02 1.483740E-02 746 40 4.452000E-02 1.381910E-02 746 41 4.585000E-02 1.284200E-02 746 42 4.718000E-02 1.191610E-02 746 43 4.850000E-02 1.104900E-02 746 44 4.983000E-02 1.022860E-02 746 45 5.049000E-02 9.841570E-03 746 46 5.116000E-02 9.462340E-03 746 47 5.248000E-02 8.755570E-03 746 48 5.381000E-02 8.097410E-03 746 49 5.514000E-02 7.492940E-03 746 50 5.580000E-02 7.212650E-03 746 51 5.646000E-02 6.945250E-03 746 52 5.779000E-02 6.444890E-03 746 53 5.911000E-02 5.997970E-03 746 54 6.044000E-02 5.596020E-03 746 55 6.110000E-02 5.413980E-03 746 56 6.176000E-02 5.243170E-03 746 57 6.309000E-02 4.931940E-03 746 58 6.640000E-02 4.335000E-03 746 59 7.169000E-02 3.823380E-03 746 60 7.698000E-02 3.705240E-03 746 61 8.227000E-02 3.816010E-03 746 62 8.755000E-02 4.017000E-03 746 63 9.282000E-02 4.207970E-03 746 64 9.809000E-02 4.330280E-03 746 65 1.034000E-01 4.361250E-03 746 66 1.086000E-01 4.306890E-03 746 67 1.139000E-01 4.187160E-03 746 68 1.191000E-01 4.033830E-03 746 69 1.244000E-01 3.866510E-03 746 70 1.296000E-01 3.708940E-03 746 71 1.348000E-01 3.566090E-03 746 72 1.400000E-01 3.438070E-03 746 73 1.452000E-01 3.319720E-03 746 74 1.504000E-01 3.203930E-03 746 75 1.556000E-01 3.084530E-03 746 76 1.608000E-01 2.958220E-03 746 77 1.660000E-01 2.825120E-03 746 78 1.712000E-01 2.688250E-03 746 79 1.763000E-01 2.554760E-03 746 80 1.815000E-01 2.423950E-03 #