data_SASDDC5_MAIN # _sas_result.id 875 _sas_result.SASBDB_code SASDDC5 _sas_result.experimental_MW 173.000 _sas_result.experimental_MW_error 20.000 _sas_result.MW_standard . _sas_result.MW_standard_error . _sas_result.MW_Porod 109.000 _sas_result.MW_Porod_error 10.000 _sas_result.I0_from_PR 1.1660000000 _sas_result.I0_from_PR_error 0.0030000000 _sas_result.I0_from_Guinier 1.1400000000 _sas_result.I0_from_Guinier_error 0.0030000000 _sas_result.Rg_from_PR 3.870 _sas_result.Rg_from_PR_error 0.100 _sas_result.Rg_from_Guinier 3.857 _sas_result.Rg_from_Guinier_error 0.330 _sas_result.D_max 12.50 _sas_result.Porod_volume 173.00 _sas_result.Porod_volume_error 20.00 _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min 9 _sas_result.Guinier_point_max 19 _sas_result.type_of_curve single_conc _sas_result.standard water _sas_result.Dmax_error 0.50 _sas_result.comments 'MsbA ABC transporter protein encapsulated in a partially deuterated "stealth-nanodisc": (sND). Disc components (MSP1D1 scaffold protein - 75% deuterated, and POPC lipid - heads/tails 78% and 92% deuterated) are effectively matched out at 100% D2O. Thus the expected molecular weight should correspond to that of the MsbA protein (~132 kDa). Data measured in two configurations: 1.5 m / 1.5 m and 8 m / 8 m (collimation length / sample-detector distances) with a fixed neutron wavelength (λ) of 5 Å. Data is merged from these two configurations.' # _sas_scan.title "(100% D2O) MsbA in stealth nanodisc + 1mM ADP" _sas_scan.detc_id 50 _sas_scan.id 875 _sas_scan.measurement_date 2017-03-09 _sas_scan.storage_temperature 10.0 _sas_scan.cell_temperature 10.0 _sas_scan.exposure_time 4200.000 _sas_scan.number_of_frames 2 _sas_scan.unit 1/A _sas_scan.qmin 0.0097 _sas_scan.qmax 0.3022 _sas_scan.sample_id 835 _sas_scan.result_id 875 _sas_scan.beam_id 73 # _sas_beam.id 73 _sas_beam.instrument_name "ILL D11" _sas_beam.instrument_city Grenoble _sas_beam.instrument_country France _sas_beam.shape . _sas_beam.type_of_source "neutron source" _sas_beam.radiation_wavelength 0.460000 _sas_beam.dist_spec_to_detc . # _sas_detc.id 50 _sas_detc.name CERCA _sas_detc.type "3-He gas detector" _sas_detc.pixsize_x 7.500 # _sas_sample.id 835 _sas_sample.name "MsbA in stealth nanodisc (SANS, 100% D2O) + 1 mM ADP" _sas_sample.ext_coefficient . _sas_sample.contrast -3.313 _sas_sample.specific_vol 0.7450 _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration 1.00-6.50 _sas_sample.concentration_method A280 loop_ _sas_sample.entity_id 1016 1017 1018 # _sas_buffer.id 509 _sas_buffer.name "30 mM Tris, 150 mM NaCl, 1 mM ADP" _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.500 _sas_buffer.comment "nanodisc buffer" _sas_buffer.composition . _sas_buffer.sample_id 835 # loop_ _entity.id _entity.type _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules 1016 protein "Lipid A export ATP-binding/permease protein MsbA" 66.279 2 1017 protein "Membrane scaffold protein 1D1 (deuterated, 75%)" 24.661 2 1018 other "1-palmitoyl-2-palmitoleoyl-sn-glycero-3-phosphocholine (deuteration: 78% head, 92% acyl)" 0.760 . # loop_ _entity_name_com.entity_id _entity_name_com.name 1016 MsbA 1017 d75-msp1d1 1018 d(78,92)-POPC # loop_ _entity_poly.entity_id _entity_poly.pdbx_seq_one_letter_code 1016 ;MHHHHHHGENLYFQGSHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD RSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ ; 1017 ;GHHHHHHHDYDIPTTENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEM SKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQE KLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEY HAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ ; 1018 C42H82NO8P # loop_ _entity_src_gen.entity_id _entity_src_gen.gene_src_common_name 1016 "Escherichia coli (strain K12)" 1017 . 1018 "Escherichia coli. (AL95 strain)" # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code 1 1016 UniProt P60752 2 1017 UniProt . 3 1018 UniProt . _struct_ref.details http://www.uniprot.org/uniprot/P60752 # _citation.id 352 _citation.title "Conformational States of ABC Transporter MsbA in a Lipid Environment Investigated by Small-Angle Scattering Using Stealth Carrier Nanodiscs." _citation.year "2018 Aug 7" _citation.pdbx_database_id_DOI 10.1016/j.str.2018.05.007 _citation.pdbx_database_id_PubMed 29937358 _citation.journal_abbrev Structure _citation.journal_volume 26 _citation.journal_issue 8 # loop_ _citation_author.citation_id _citation_author.ordinal _citation_author.name 352 1 "Josts I" 352 2 "Nitsche J" 352 3 "Maric S" 352 4 "Mertens HD" 352 5 "Moulin M" 352 6 "Haertlein M" 352 7 "Prevost S" 352 8 "Svergun DI" 352 9 "Busch S" 352 10 "Forsyth VT" # _pdbx_contact_author.id 12 _pdbx_contact_author.name_first Haydyn _pdbx_contact_author.name_last Mertens _pdbx_contact_author.role . _pdbx_contact_author.address_1 EMBL-Hamburg _pdbx_contact_author.address_2 "European Molecular Biology Laboratory (EMBL) - Hamburg outstation" _pdbx_contact_author.address_3 "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany" # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 9.720523E-03 1.122770E+00 2.847599E-02 875 2 1.100038E-02 1.121928E+00 1.040434E-02 875 3 1.228022E-02 1.113745E+00 7.660000E-03 875 4 1.356003E-02 1.087920E+00 6.328684E-03 875 5 1.483982E-02 1.068899E+00 5.712614E-03 875 6 1.611958E-02 1.041450E+00 5.348527E-03 875 7 1.739930E-02 1.020239E+00 5.101155E-03 875 8 1.867899E-02 9.832044E-01 4.757037E-03 875 9 1.995865E-02 9.414240E-01 4.567567E-03 875 10 2.123826E-02 9.196234E-01 4.343257E-03 875 11 2.251784E-02 8.895543E-01 4.165345E-03 875 12 2.379736E-02 8.616853E-01 4.006717E-03 875 13 2.507684E-02 8.403122E-01 3.852506E-03 875 14 2.635627E-02 8.153436E-01 3.775023E-03 875 15 2.763566E-02 7.834874E-01 3.585802E-03 875 16 2.891498E-02 7.578218E-01 3.493306E-03 875 17 3.019425E-02 7.288138E-01 3.364665E-03 875 18 3.147345E-02 7.013727E-01 3.231047E-03 875 19 3.275260E-02 6.738933E-01 3.166514E-03 875 20 3.403168E-02 6.493910E-01 3.038095E-03 875 21 3.531069E-02 6.249929E-01 2.980294E-03 875 22 3.658964E-02 5.970540E-01 2.875139E-03 875 23 3.786851E-02 5.683660E-01 2.789040E-03 875 24 3.914731E-02 5.445424E-01 2.732044E-03 875 25 4.042603E-02 5.187962E-01 2.617099E-03 875 26 4.170467E-02 4.956021E-01 2.583075E-03 875 27 4.298323E-02 4.723369E-01 2.483339E-03 875 28 4.426170E-02 4.512492E-01 2.429151E-03 875 29 4.554009E-02 4.264049E-01 2.344357E-03 875 30 4.681838E-02 4.020188E-01 2.262767E-03 875 31 4.809659E-02 3.827015E-01 2.233587E-03 875 32 4.937470E-02 3.662576E-01 2.170152E-03 875 33 5.065271E-02 3.468355E-01 2.122056E-03 875 34 5.193062E-02 3.268462E-01 2.065336E-03 875 35 5.320843E-02 3.093911E-01 2.014213E-03 875 36 5.448613E-02 2.953955E-01 1.990712E-03 875 37 5.576373E-02 2.799179E-01 1.935977E-03 875 38 5.704122E-02 2.645396E-01 1.897270E-03 875 39 5.831860E-02 2.513915E-01 1.849142E-03 875 40 5.959585E-02 2.382461E-01 1.816208E-03 875 41 6.087300E-02 2.250362E-01 1.779271E-03 875 42 6.215002E-02 2.114592E-01 1.723032E-03 875 43 6.342692E-02 2.026322E-01 1.711126E-03 875 44 6.470370E-02 1.908919E-01 1.666692E-03 875 45 6.598035E-02 1.824546E-01 1.647613E-03 875 46 6.725685E-02 1.736179E-01 1.877772E-03 875 47 6.853325E-02 1.647016E-01 2.854254E-03 875 48 6.980950E-02 1.558427E-01 2.114937E-03 875 49 7.108561E-02 1.491639E-01 1.748456E-03 875 50 7.236158E-02 1.441252E-01 1.639525E-03 875 51 7.363742E-02 1.368082E-01 1.585934E-03 875 52 7.491311E-02 1.300042E-01 1.713635E-03 875 53 7.618864E-02 1.243448E-01 1.530649E-03 875 54 7.746403E-02 1.199520E-01 1.454347E-03 875 55 7.873927E-02 1.153512E-01 1.454151E-03 875 56 8.001435E-02 1.097759E-01 1.534551E-03 875 57 8.128928E-02 1.054773E-01 3.017978E-03 875 58 8.256405E-02 9.162985E-02 7.334374E-03 875 59 8.383865E-02 8.926687E-02 2.981880E-03 875 60 8.511309E-02 8.685576E-02 1.825666E-03 875 61 8.638736E-02 8.643179E-02 1.552874E-03 875 62 8.766146E-02 8.454291E-02 1.373999E-03 875 63 8.893541E-02 8.226240E-02 2.041672E-03 875 64 8.992387E-02 8.174929E-02 5.628135E-03 875 65 9.020914E-02 8.063765E-02 1.970367E-03 875 66 9.148273E-02 7.742954E-02 1.400022E-03 875 67 9.275614E-02 7.433957E-02 1.404022E-03 875 68 9.402934E-02 7.101494E-02 1.437110E-03 875 69 9.530237E-02 6.730665E-02 1.423816E-03 875 70 9.657524E-02 6.467652E-02 2.940608E-03 875 71 9.714752E-02 6.370250E-02 3.160502E-03 875 72 9.784788E-02 6.226981E-02 1.651316E-03 875 73 9.912035E-02 6.007725E-02 1.608212E-03 875 74 1.003926E-01 5.694607E-02 2.229244E-03 875 75 1.016647E-01 5.580471E-02 4.724563E-03 875 76 1.029366E-01 5.492031E-02 2.460760E-03 875 77 1.042082E-01 5.176210E-02 2.235831E-03 875 78 1.043651E-01 4.518514E-02 2.061589E-03 875 79 1.115760E-01 3.737839E-02 1.159174E-03 875 80 1.187800E-01 2.727928E-02 7.919741E-04 875 81 1.259765E-01 1.993940E-02 5.874684E-04 875 82 1.331651E-01 1.578586E-02 5.432084E-04 875 83 1.403454E-01 1.337318E-02 5.334933E-04 875 84 1.475170E-01 1.258454E-02 5.191543E-04 875 85 1.546793E-01 1.178141E-02 5.033945E-04 875 86 1.618320E-01 1.129638E-02 4.996217E-04 875 87 1.689748E-01 1.080016E-02 4.822832E-04 875 88 1.761070E-01 1.028304E-02 4.755403E-04 875 89 1.832284E-01 9.519751E-03 4.631032E-04 875 90 1.903386E-01 8.197976E-03 4.555733E-04 875 91 1.974370E-01 7.556330E-03 4.515780E-04 875 92 2.045233E-01 6.931032E-03 4.385290E-04 875 93 2.115971E-01 6.008944E-03 4.361624E-04 875 94 2.186581E-01 5.839675E-03 4.252972E-04 875 95 2.257058E-01 5.523576E-03 4.224154E-04 875 96 2.327399E-01 5.044120E-03 4.163127E-04 875 97 2.397598E-01 4.560832E-03 4.081936E-04 875 98 2.467654E-01 3.744404E-03 4.058375E-04 875 99 2.537561E-01 3.532846E-03 3.958450E-04 875 100 2.607317E-01 3.299192E-03 3.933561E-04 875 101 2.676918E-01 2.880309E-03 3.876136E-04 875 102 2.746359E-01 2.801044E-03 3.835458E-04 875 103 2.815639E-01 2.508503E-03 3.810579E-04 875 104 2.884752E-01 2.398261E-03 3.729017E-04 875 105 2.953697E-01 2.111173E-03 3.716960E-04 875 106 3.022468E-01 1.896600E-03 3.668193E-04 875 # _sas_p_of_R_details.id 875 _sas_p_of_R_details.intensity_id 875 _sas_p_of_R_details.software_p_of_R "GNOM 5.0" _sas_p_of_R_details.number_of_points 98 _sas_p_of_R_details.qmin 0.0199587 _sas_p_of_R_details.qmax 0.302247 _sas_p_of_R_details.p_of_R_point_min 1 _sas_p_of_R_details.p_of_R_point_max 98 _sas_p_of_R_details.Rmin 0.0 _sas_p_of_R_details.Rmax 125.0 # loop_ _sas_p_of_R.id _sas_p_of_R.ordinal _sas_p_of_R.r _sas_p_of_R.P _sas_p_of_R.P_error 875 1 0.000000E+00 0.000000E+00 0.000000E+00 875 2 1.761000E+00 3.602000E-05 2.253000E-06 875 3 3.521000E+00 9.079000E-05 2.658000E-06 875 4 5.282000E+00 1.622000E-04 1.817000E-06 875 5 7.042000E+00 2.472000E-04 1.309000E-06 875 6 8.803000E+00 3.419000E-04 2.510000E-06 875 7 1.056000E+01 4.426000E-04 3.579000E-06 875 8 1.232000E+01 5.457000E-04 3.848000E-06 875 9 1.408000E+01 6.483000E-04 3.368000E-06 875 10 1.585000E+01 7.486000E-04 2.814000E-06 875 11 1.761000E+01 8.453000E-04 3.199000E-06 875 12 1.937000E+01 9.381000E-04 4.231000E-06 875 13 2.113000E+01 1.027000E-03 4.979000E-06 875 14 2.289000E+01 1.111000E-03 5.044000E-06 875 15 2.465000E+01 1.191000E-03 4.567000E-06 875 16 2.641000E+01 1.266000E-03 4.195000E-06 875 17 2.817000E+01 1.334000E-03 4.588000E-06 875 18 2.993000E+01 1.394000E-03 5.448000E-06 875 19 3.169000E+01 1.445000E-03 6.029000E-06 875 20 3.345000E+01 1.484000E-03 5.972000E-06 875 21 3.521000E+01 1.511000E-03 5.470000E-06 875 22 3.697000E+01 1.524000E-03 5.266000E-06 875 23 3.873000E+01 1.524000E-03 5.984000E-06 875 24 4.049000E+01 1.513000E-03 7.200000E-06 875 25 4.225000E+01 1.491000E-03 8.084000E-06 875 26 4.401000E+01 1.460000E-03 8.144000E-06 875 27 4.577000E+01 1.423000E-03 7.370000E-06 875 28 4.754000E+01 1.381000E-03 6.281000E-06 875 29 4.930000E+01 1.337000E-03 5.866000E-06 875 30 5.106000E+01 1.293000E-03 6.639000E-06 875 31 5.282000E+01 1.248000E-03 7.858000E-06 875 32 5.458000E+01 1.204000E-03 8.656000E-06 875 33 5.634000E+01 1.162000E-03 8.684000E-06 875 34 5.810000E+01 1.122000E-03 8.086000E-06 875 35 5.986000E+01 1.084000E-03 7.391000E-06 875 36 6.162000E+01 1.048000E-03 7.228000E-06 875 37 6.338000E+01 1.014000E-03 7.757000E-06 875 38 6.514000E+01 9.823000E-04 8.552000E-06 875 39 6.690000E+01 9.526000E-04 9.183000E-06 875 40 6.866000E+01 9.244000E-04 9.535000E-06 875 41 7.042000E+01 8.972000E-04 9.749000E-06 875 42 7.218000E+01 8.703000E-04 1.003000E-05 875 43 7.394000E+01 8.427000E-04 1.043000E-05 875 44 7.570000E+01 8.137000E-04 1.084000E-05 875 45 7.746000E+01 7.826000E-04 1.110000E-05 875 46 7.923000E+01 7.487000E-04 1.112000E-05 875 47 8.099000E+01 7.116000E-04 1.095000E-05 875 48 8.275000E+01 6.714000E-04 1.069000E-05 875 49 8.451000E+01 6.280000E-04 1.047000E-05 875 50 8.627000E+01 5.820000E-04 1.042000E-05 875 51 8.803000E+01 5.337000E-04 1.060000E-05 875 52 8.979000E+01 4.841000E-04 1.101000E-05 875 53 9.155000E+01 4.338000E-04 1.156000E-05 875 54 9.331000E+01 3.837000E-04 1.212000E-05 875 55 9.507000E+01 3.347000E-04 1.257000E-05 875 56 9.683000E+01 2.878000E-04 1.285000E-05 875 57 9.859000E+01 2.438000E-04 1.301000E-05 875 58 1.004000E+02 2.036000E-04 1.315000E-05 875 59 1.021000E+02 1.680000E-04 1.330000E-05 875 60 1.039000E+02 1.373000E-04 1.346000E-05 875 61 1.056000E+02 1.118000E-04 1.358000E-05 875 62 1.074000E+02 9.149000E-05 1.368000E-05 875 63 1.092000E+02 7.580000E-05 1.390000E-05 875 64 1.109000E+02 6.401000E-05 1.441000E-05 875 65 1.127000E+02 5.516000E-05 1.523000E-05 875 66 1.144000E+02 4.816000E-05 1.618000E-05 875 67 1.162000E+02 4.195000E-05 1.688000E-05 875 68 1.180000E+02 3.563000E-05 1.688000E-05 875 69 1.197000E+02 2.851000E-05 1.566000E-05 875 70 1.215000E+02 2.023000E-05 1.274000E-05 875 71 1.232000E+02 1.070000E-05 7.651000E-06 875 72 1.250000E+02 0.000000E+00 0.000000E+00 # loop_ _sas_p_of_R_extrapolated_intensity.id _sas_p_of_R_extrapolated_intensity.ordinal _sas_p_of_R_extrapolated_intensity.momentum_transfer _sas_p_of_R_extrapolated_intensity.intensity_reg 875 1 0.000000E+00 1.146890E+00 875 2 1.247420E-03 1.145990E+00 875 3 2.494830E-03 1.143300E+00 875 4 3.742250E-03 1.138820E+00 875 5 4.989660E-03 1.132590E+00 875 6 6.237080E-03 1.124640E+00 875 7 7.484490E-03 1.114990E+00 875 8 8.731910E-03 1.103700E+00 875 9 9.979330E-03 1.090830E+00 875 10 1.122670E-02 1.076430E+00 875 11 1.247420E-02 1.060580E+00 875 12 1.372160E-02 1.043340E+00 875 13 1.496900E-02 1.024810E+00 875 14 1.621640E-02 1.005070E+00 875 15 1.746380E-02 9.841980E-01 875 16 1.871120E-02 9.623020E-01 875 17 1.995870E-02 9.394760E-01 875 18 2.123830E-02 9.151980E-01 875 19 2.251780E-02 8.901550E-01 875 20 2.379740E-02 8.644610E-01 875 21 2.507680E-02 8.382240E-01 875 22 2.635630E-02 8.115550E-01 875 23 2.763570E-02 7.845650E-01 875 24 2.891500E-02 7.573600E-01 875 25 3.019420E-02 7.300450E-01 875 26 3.147350E-02 7.027220E-01 875 27 3.275260E-02 6.754880E-01 875 28 3.403170E-02 6.484360E-01 875 29 3.531070E-02 6.216540E-01 875 30 3.658960E-02 5.952260E-01 875 31 3.786850E-02 5.692270E-01 875 32 3.914730E-02 5.437300E-01 875 33 4.042600E-02 5.187970E-01 875 34 4.170470E-02 4.944880E-01 875 35 4.298320E-02 4.708540E-01 875 36 4.426170E-02 4.479390E-01 875 37 4.554010E-02 4.257820E-01 875 38 4.681840E-02 4.044140E-01 875 39 4.809660E-02 3.838590E-01 875 40 4.937470E-02 3.641370E-01 875 41 5.065270E-02 3.452590E-01 875 42 5.193060E-02 3.272330E-01 875 43 5.320840E-02 3.100580E-01 875 44 5.448610E-02 2.937320E-01 875 45 5.576370E-02 2.782450E-01 875 46 5.704120E-02 2.635820E-01 875 47 5.831860E-02 2.497270E-01 875 48 5.959580E-02 2.366590E-01 875 49 6.087300E-02 2.243520E-01 875 50 6.215000E-02 2.127800E-01 875 51 6.342690E-02 2.019140E-01 875 52 6.470370E-02 1.917200E-01 875 53 6.598030E-02 1.821670E-01 875 54 6.725690E-02 1.732210E-01 875 55 6.853330E-02 1.648460E-01 875 56 6.980950E-02 1.570080E-01 875 57 7.108560E-02 1.496720E-01 875 58 7.236160E-02 1.428020E-01 875 59 7.363740E-02 1.363640E-01 875 60 7.491310E-02 1.303260E-01 875 61 7.618860E-02 1.246550E-01 875 62 7.746400E-02 1.193210E-01 875 63 7.873930E-02 1.142930E-01 875 64 8.001430E-02 1.095450E-01 875 65 8.128930E-02 1.050500E-01 875 66 8.256400E-02 1.007840E-01 875 67 8.383870E-02 9.672530E-02 875 68 8.511310E-02 9.285320E-02 875 69 8.638740E-02 8.914940E-02 875 70 8.766150E-02 8.559740E-02 875 71 8.893540E-02 8.218230E-02 875 72 8.992390E-02 7.961820E-02 875 73 9.020910E-02 7.889160E-02 875 74 9.148270E-02 7.571350E-02 875 75 9.275610E-02 7.263910E-02 875 76 9.402930E-02 6.966030E-02 875 77 9.530240E-02 6.677030E-02 875 78 9.657520E-02 6.396400E-02 875 79 9.714750E-02 6.272830E-02 875 80 9.784790E-02 6.123740E-02 875 81 9.912030E-02 5.858740E-02 875 82 1.003930E-01 5.601200E-02 875 83 1.016650E-01 5.350960E-02 875 84 1.029370E-01 5.108030E-02 875 85 1.042080E-01 4.872320E-02 875 86 1.043650E-01 4.843740E-02 875 87 1.115760E-01 3.652930E-02 875 88 1.187800E-01 2.716320E-02 875 89 1.259760E-01 2.040680E-02 875 90 1.331650E-01 1.603750E-02 875 91 1.403450E-01 1.356050E-02 875 92 1.475170E-01 1.234550E-02 875 93 1.546790E-01 1.178040E-02 875 94 1.618320E-01 1.138750E-02 875 95 1.689750E-01 1.088090E-02 875 96 1.761070E-01 1.016390E-02 875 97 1.832280E-01 9.283480E-03 875 98 1.903390E-01 8.360530E-03 875 99 1.974370E-01 7.516640E-03 875 100 2.045230E-01 6.821460E-03 875 101 2.115970E-01 6.273850E-03 875 102 2.186580E-01 5.819360E-03 875 103 2.257060E-01 5.388650E-03 875 104 2.327400E-01 4.935820E-03 875 105 2.397600E-01 4.457410E-03 875 106 2.467650E-01 3.985620E-03 875 107 2.537560E-01 3.563670E-03 875 108 2.607320E-01 3.219570E-03 875 109 2.676920E-01 2.952830E-03 875 110 2.746360E-01 2.739530E-03 875 111 2.815640E-01 2.549510E-03 875 112 2.884750E-01 2.363860E-03 875 113 2.953700E-01 2.182610E-03 875 114 3.022470E-01 2.019640E-03 #