data_SASDCC9_MAIN # _sas_result.id 747 _sas_result.SASBDB_code SASDCC9 _sas_result.experimental_MW 142.000 _sas_result.experimental_MW_error . _sas_result.MW_standard . _sas_result.MW_standard_error . _sas_result.MW_Porod . _sas_result.MW_Porod_error . _sas_result.I0_from_PR 0.0430000000 _sas_result.I0_from_PR_error 0.0010000000 _sas_result.I0_from_Guinier 0.0440000000 _sas_result.I0_from_Guinier_error 0.0008400000 _sas_result.Rg_from_PR 2.870 _sas_result.Rg_from_PR_error 0.060 _sas_result.Rg_from_Guinier 2.910 _sas_result.Rg_from_Guinier_error 0.190 _sas_result.D_max 7.27 _sas_result.Porod_volume . _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min 1 _sas_result.Guinier_point_max 28 _sas_result.type_of_curve single_conc _sas_result.standard . _sas_result.Dmax_error . _sas_result.comments "Additional SANS measurement parameters. Two detector positions (in m) and count times (s) were employed: 1.33 m (two frames of 900 + 831 = 1731 s total count time); 4 m (two frames of 3600 + 3600 = 7200 s total count time)." # _sas_scan.title "Nanolipoprotein Particle (NLP) from In Vitro Assembly - 42% D2O SANS" _sas_scan.detc_id 43 _sas_scan.id 747 _sas_scan.measurement_date 2015-12-11 _sas_scan.storage_temperature 4.0 _sas_scan.cell_temperature 25.0 _sas_scan.exposure_time 3600.000 _sas_scan.number_of_frames 2 _sas_scan.unit 1/A _sas_scan.qmin 0.0100 _sas_scan.qmax 0.4768 _sas_scan.sample_id 707 _sas_scan.result_id 747 _sas_scan.beam_id 65 # _sas_beam.id 65 _sas_beam.instrument_name "NIST Center for Neutron Research NGB30" _sas_beam.instrument_city "Gaithersburg, MD" _sas_beam.instrument_country USA _sas_beam.shape . _sas_beam.type_of_source "neutron source" _sas_beam.radiation_wavelength 0.600000 _sas_beam.dist_spec_to_detc 4.00000 # _sas_detc.id 43 _sas_detc.name "Ordela 2660N" _sas_detc.type "640x640 mm 3He posn sensitive prop counter" _sas_detc.pixsize_x 5.080 # _sas_sample.id 707 _sas_sample.name "Nanolipoprotein Particle (NLP) from In Vitro Assembly - 42% D2O SANS" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration 0.96 _sas_sample.concentration_method . loop_ _sas_sample.entity_id 861 862 # _sas_buffer.id 431 _sas_buffer.name "PBS in 42% D2O" _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.400 _sas_buffer.comment "8 g/L NaCl, 0.2 g/L KH2PO4, 1.15 g/L Na2HPO4, 0.2 g/L KCl, in 42% D2O with no further pH adjustment" _sas_buffer.composition . _sas_buffer.sample_id 707 # loop_ _entity.id _entity.type _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules 861 protein "Apolipoprotein A-I" 25.153 2 862 other 1,2-dimyristoyl-sn-glycero-3-phosphocholine 0.678 . # loop_ _entity_name_com.entity_id _entity_name_com.name 861 ApoA-I 862 DMPC # loop_ _entity_poly.entity_id _entity_poly.pdbx_seq_one_letter_code 861 MHHHHHHGENLYFQGMLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTKAQSVIDKASETLTAQ 862 N/A # loop_ _entity_src_gen.entity_id _entity_src_gen.gene_src_common_name 861 "Mus musculus" 862 . # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code 1 861 UniProt Q00623 2 862 UniProt . _struct_ref.details http://www.uniprot.org/uniprot/Q00623 # _citation.id 305 _citation.title "Small-angle X-ray and neutron scattering demonstrates that cell-free expression produces properly formed disc-shaped nanolipoprotein particles." _citation.year "2017 Dec 20" _citation.pdbx_database_id_DOI 10.1002/pro.3365 _citation.pdbx_database_id_PubMed 29266475 # loop_ _citation_author.citation_id _citation_author.ordinal _citation_author.name 305 1 "Cleveland TE 4th" 305 2 "He W" 305 3 "Evans AC" 305 4 "Fischer NO" 305 5 "Lau EY" 305 6 "Coleman MA" # _pdbx_contact_author.id 197 _pdbx_contact_author.name_first Thomas _pdbx_contact_author.name_last Cleveland _pdbx_contact_author.role . _pdbx_contact_author.address_1 . _pdbx_contact_author.address_2 "National Institute of Standards and Technology, Gaithersburg, MD, USA" _pdbx_contact_author.address_3 . # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 9.974000E-03 4.071000E-02 7.048000E-03 747 2 1.130000E-02 4.061000E-02 6.378000E-03 747 3 1.263000E-02 3.641000E-02 5.810000E-03 747 4 1.396000E-02 4.241000E-02 5.070000E-03 747 5 1.529000E-02 4.341000E-02 4.716000E-03 747 6 1.662000E-02 3.971000E-02 4.572000E-03 747 7 1.795000E-02 3.841000E-02 4.113000E-03 747 8 1.928000E-02 4.101000E-02 3.959000E-03 747 9 2.061000E-02 3.321000E-02 4.313000E-03 747 10 2.194000E-02 3.801000E-02 4.154000E-03 747 11 2.327000E-02 3.771000E-02 4.027000E-03 747 12 2.460000E-02 4.001000E-02 3.556000E-03 747 13 2.593000E-02 3.701000E-02 3.604000E-03 747 14 2.726000E-02 3.801000E-02 3.217000E-03 747 15 2.859000E-02 3.441000E-02 3.357000E-03 747 16 2.991000E-02 3.401000E-02 3.163000E-03 747 17 3.124000E-02 3.401000E-02 3.256000E-03 747 18 3.257000E-02 2.941000E-02 3.233000E-03 747 19 3.390000E-02 2.991000E-02 3.263000E-03 747 20 3.523000E-02 3.241000E-02 2.748000E-03 747 21 3.656000E-02 2.861000E-02 2.566000E-03 747 22 3.788000E-02 2.831000E-02 2.903000E-03 747 23 3.921000E-02 3.061000E-02 3.058000E-03 747 24 4.054000E-02 2.621000E-02 2.852000E-03 747 25 4.187000E-02 2.581000E-02 2.615000E-03 747 26 4.197000E-02 2.521000E-02 2.212000E-03 747 27 4.320000E-02 2.581000E-02 2.841000E-03 747 28 4.452000E-02 2.701000E-02 2.648000E-03 747 29 4.585000E-02 2.071000E-02 2.664000E-03 747 30 4.596000E-02 2.411000E-02 2.201000E-03 747 31 4.718000E-02 1.891000E-02 2.633000E-03 747 32 4.850000E-02 2.031000E-02 2.450000E-03 747 33 4.983000E-02 2.051000E-02 2.537000E-03 747 34 4.996000E-02 2.081000E-02 2.380000E-03 747 35 5.116000E-02 1.961000E-02 2.451000E-03 747 36 5.248000E-02 1.791000E-02 2.467000E-03 747 37 5.381000E-02 2.121000E-02 2.406000E-03 747 38 5.394000E-02 1.891000E-02 2.085000E-03 747 39 5.793000E-02 1.441000E-02 1.805000E-03 747 40 6.192000E-02 1.441000E-02 1.748000E-03 747 41 6.590000E-02 1.241000E-02 1.855000E-03 747 42 6.988000E-02 1.191000E-02 1.775000E-03 747 43 7.386000E-02 7.810000E-03 1.777000E-03 747 44 7.783000E-02 5.510000E-03 1.572000E-03 747 45 8.181000E-02 9.210000E-03 1.933000E-03 747 46 8.578000E-02 4.710000E-03 1.677000E-03 747 47 8.975000E-02 3.810000E-03 1.568000E-03 747 48 9.371000E-02 1.010000E-03 1.376000E-03 747 49 9.768000E-02 2.910000E-03 1.657000E-03 747 50 1.016000E-01 1.610000E-03 1.609000E-03 747 51 1.056000E-01 2.610000E-03 1.548000E-03 747 52 1.095000E-01 2.210000E-03 1.460000E-03 747 53 1.135000E-01 2.610000E-03 1.606000E-03 747 54 1.174000E-01 9.100000E-04 1.579000E-03 747 55 1.214000E-01 -5.900000E-04 1.393000E-03 747 56 1.253000E-01 1.510000E-03 1.402000E-03 747 57 1.293000E-01 3.510000E-03 1.393000E-03 747 58 1.332000E-01 -1.290000E-03 1.580000E-03 747 59 1.371000E-01 1.110000E-03 1.355000E-03 747 60 1.410000E-01 1.210000E-03 1.273000E-03 747 61 1.449000E-01 -2.900000E-04 1.350000E-03 747 62 1.489000E-01 -2.490000E-03 1.321000E-03 747 63 1.528000E-01 2.210000E-03 1.498000E-03 747 64 1.567000E-01 2.210000E-03 1.318000E-03 747 65 1.606000E-01 -9.000000E-05 1.368000E-03 747 66 1.645000E-01 8.100000E-04 1.191000E-03 747 67 1.683000E-01 6.100000E-04 1.300000E-03 747 68 1.722000E-01 -4.900000E-04 1.242000E-03 747 69 1.761000E-01 -1.390000E-03 1.140000E-03 747 70 1.800000E-01 1.910000E-03 1.279000E-03 747 71 1.838000E-01 2.100000E-04 1.357000E-03 747 72 1.877000E-01 1.610000E-03 1.383000E-03 747 73 1.915000E-01 3.010000E-03 1.161000E-03 747 74 1.954000E-01 3.100000E-04 1.284000E-03 747 75 1.992000E-01 2.010000E-03 1.175000E-03 747 76 2.031000E-01 -5.900000E-04 1.187000E-03 747 77 2.069000E-01 4.100000E-04 1.174000E-03 747 78 2.107000E-01 -3.900000E-04 1.099000E-03 747 79 2.145000E-01 -1.990000E-03 1.125000E-03 747 80 2.184000E-01 -1.290000E-03 1.094000E-03 747 81 2.222000E-01 -5.900000E-04 1.197000E-03 747 82 2.260000E-01 7.100000E-04 1.181000E-03 747 83 2.297000E-01 -5.900000E-04 1.279000E-03 747 84 2.335000E-01 -6.900000E-04 1.174000E-03 747 85 2.373000E-01 4.100000E-04 1.186000E-03 747 86 2.411000E-01 1.000000E-05 1.163000E-03 747 87 2.448000E-01 -3.090000E-03 1.210000E-03 747 88 2.486000E-01 1.910000E-03 1.173000E-03 747 89 2.523000E-01 -1.690000E-03 1.249000E-03 747 90 2.561000E-01 4.100000E-04 1.250000E-03 747 91 2.598000E-01 2.110000E-03 1.210000E-03 747 92 2.635000E-01 1.110000E-03 1.302000E-03 747 93 2.673000E-01 -1.900000E-04 1.128000E-03 747 94 2.710000E-01 -1.090000E-03 1.300000E-03 747 95 2.747000E-01 -9.900000E-04 1.335000E-03 747 96 2.784000E-01 -2.090000E-03 1.419000E-03 747 97 2.820000E-01 -4.900000E-04 1.380000E-03 747 98 2.857000E-01 -4.900000E-04 1.355000E-03 747 99 2.894000E-01 -5.900000E-04 1.158000E-03 747 100 2.930000E-01 1.310000E-03 1.423000E-03 747 101 2.967000E-01 -1.290000E-03 1.268000E-03 747 102 3.003000E-01 1.100000E-04 1.218000E-03 747 103 3.040000E-01 -9.900000E-04 1.449000E-03 747 104 3.076000E-01 -1.490000E-03 1.463000E-03 747 105 3.112000E-01 -1.190000E-03 1.243000E-03 747 106 3.148000E-01 2.100000E-04 1.490000E-03 747 107 3.184000E-01 -2.490000E-03 1.468000E-03 747 108 3.220000E-01 -1.690000E-03 1.502000E-03 747 109 3.256000E-01 -8.900000E-04 1.561000E-03 747 110 3.292000E-01 -1.790000E-03 1.484000E-03 747 111 3.327000E-01 -2.790000E-03 1.380000E-03 747 112 3.363000E-01 -7.900000E-04 1.218000E-03 747 113 3.398000E-01 -2.090000E-03 1.366000E-03 747 114 3.434000E-01 -1.490000E-03 1.379000E-03 747 115 3.469000E-01 1.100000E-04 1.440000E-03 747 116 3.504000E-01 -1.890000E-03 1.476000E-03 747 117 3.539000E-01 4.100000E-04 1.411000E-03 747 118 3.574000E-01 -2.090000E-03 1.391000E-03 747 119 3.609000E-01 -2.890000E-03 1.421000E-03 747 120 3.644000E-01 -1.990000E-03 1.356000E-03 747 121 3.679000E-01 -3.890000E-03 1.488000E-03 747 122 3.713000E-01 -5.490000E-03 1.474000E-03 747 123 3.748000E-01 -4.790000E-03 1.397000E-03 747 124 3.782000E-01 -2.890000E-03 1.344000E-03 747 125 3.817000E-01 -2.590000E-03 1.436000E-03 747 126 3.851000E-01 -3.490000E-03 1.458000E-03 747 127 3.885000E-01 -3.890000E-03 1.513000E-03 747 128 3.919000E-01 -1.890000E-03 1.536000E-03 747 129 3.953000E-01 -2.990000E-03 1.512000E-03 747 130 3.987000E-01 -4.490000E-03 1.427000E-03 747 131 4.021000E-01 -2.490000E-03 1.619000E-03 747 132 4.054000E-01 -4.190000E-03 1.687000E-03 747 133 4.088000E-01 -4.890000E-03 1.400000E-03 747 134 4.121000E-01 -3.290000E-03 1.556000E-03 747 135 4.155000E-01 -3.490000E-03 1.631000E-03 747 136 4.188000E-01 -2.690000E-03 1.388000E-03 747 137 4.221000E-01 -6.890000E-03 1.619000E-03 747 138 4.254000E-01 -3.790000E-03 1.531000E-03 747 139 4.287000E-01 -4.990000E-03 1.829000E-03 747 140 4.320000E-01 -3.390000E-03 1.981000E-03 747 141 4.352000E-01 -7.890000E-03 2.010000E-03 747 142 4.385000E-01 -4.690000E-03 2.289000E-03 747 143 4.417000E-01 -5.990000E-03 2.222000E-03 747 144 4.450000E-01 -3.490000E-03 2.687000E-03 747 145 4.482000E-01 -8.990000E-03 2.595000E-03 747 146 4.514000E-01 -4.290000E-03 2.703000E-03 747 147 4.546000E-01 2.100000E-04 3.076000E-03 747 148 4.578000E-01 -6.290000E-03 4.009000E-03 747 149 4.610000E-01 -5.190000E-03 4.539000E-03 747 150 4.642000E-01 3.100000E-04 3.999000E-03 747 151 4.674000E-01 -9.000000E-05 5.093000E-03 747 152 4.705000E-01 2.310000E-03 5.612000E-03 747 153 4.737000E-01 3.310000E-03 4.909000E-03 747 154 4.768000E-01 -1.479000E-02 2.631000E-03 747 # _sas_p_of_R_details.id 747 _sas_p_of_R_details.intensity_id 747 _sas_p_of_R_details.software_p_of_R "GNOM 5.0" _sas_p_of_R_details.number_of_points 95 _sas_p_of_R_details.qmin 0.009974 _sas_p_of_R_details.qmax 0.2747 _sas_p_of_R_details.p_of_R_point_min 1 _sas_p_of_R_details.p_of_R_point_max 95 _sas_p_of_R_details.Rmin 0.0 _sas_p_of_R_details.Rmax 72.73 # loop_ _sas_p_of_R.id _sas_p_of_R.ordinal _sas_p_of_R.r _sas_p_of_R.P _sas_p_of_R.P_error 747 1 0.000000E+00 0.000000E+00 0.000000E+00 747 2 9.570000E-01 -1.959000E-09 1.236000E-06 747 3 1.914000E+00 5.062000E-07 2.119000E-06 747 4 2.871000E+00 1.510000E-06 2.671000E-06 747 5 3.828000E+00 2.986000E-06 2.930000E-06 747 6 4.785000E+00 4.901000E-06 2.946000E-06 747 7 5.742000E+00 7.216000E-06 2.787000E-06 747 8 6.699000E+00 9.886000E-06 2.543000E-06 747 9 7.656000E+00 1.286000E-05 2.333000E-06 747 10 8.613000E+00 1.608000E-05 2.284000E-06 747 11 9.570000E+00 1.949000E-05 2.459000E-06 747 12 1.053000E+01 2.303000E-05 2.810000E-06 747 13 1.148000E+01 2.665000E-05 3.239000E-06 747 14 1.244000E+01 3.029000E-05 3.656000E-06 747 15 1.340000E+01 3.390000E-05 4.004000E-06 747 16 1.435000E+01 3.743000E-05 4.251000E-06 747 17 1.531000E+01 4.085000E-05 4.384000E-06 747 18 1.627000E+01 4.412000E-05 4.411000E-06 747 19 1.723000E+01 4.721000E-05 4.353000E-06 747 20 1.818000E+01 5.011000E-05 4.247000E-06 747 21 1.914000E+01 5.281000E-05 4.143000E-06 747 22 2.010000E+01 5.529000E-05 4.093000E-06 747 23 2.105000E+01 5.757000E-05 4.138000E-06 747 24 2.201000E+01 5.964000E-05 4.293000E-06 747 25 2.297000E+01 6.153000E-05 4.545000E-06 747 26 2.392000E+01 6.325000E-05 4.857000E-06 747 27 2.488000E+01 6.481000E-05 5.184000E-06 747 28 2.584000E+01 6.624000E-05 5.487000E-06 747 29 2.680000E+01 6.756000E-05 5.735000E-06 747 30 2.775000E+01 6.879000E-05 5.907000E-06 747 31 2.871000E+01 6.995000E-05 5.996000E-06 747 32 2.967000E+01 7.104000E-05 6.002000E-06 747 33 3.062000E+01 7.209000E-05 5.937000E-06 747 34 3.158000E+01 7.309000E-05 5.820000E-06 747 35 3.254000E+01 7.405000E-05 5.676000E-06 747 36 3.349000E+01 7.497000E-05 5.531000E-06 747 37 3.445000E+01 7.583000E-05 5.412000E-06 747 38 3.541000E+01 7.661000E-05 5.339000E-06 747 39 3.637000E+01 7.731000E-05 5.322000E-06 747 40 3.732000E+01 7.789000E-05 5.362000E-06 747 41 3.828000E+01 7.835000E-05 5.449000E-06 747 42 3.924000E+01 7.864000E-05 5.566000E-06 747 43 4.019000E+01 7.874000E-05 5.699000E-06 747 44 4.115000E+01 7.864000E-05 5.832000E-06 747 45 4.211000E+01 7.831000E-05 5.956000E-06 747 46 4.306000E+01 7.773000E-05 6.066000E-06 747 47 4.402000E+01 7.689000E-05 6.162000E-06 747 48 4.498000E+01 7.578000E-05 6.245000E-06 747 49 4.593000E+01 7.440000E-05 6.318000E-06 747 50 4.689000E+01 7.276000E-05 6.384000E-06 747 51 4.785000E+01 7.086000E-05 6.445000E-06 747 52 4.881000E+01 6.872000E-05 6.499000E-06 747 53 4.976000E+01 6.637000E-05 6.543000E-06 747 54 5.072000E+01 6.384000E-05 6.574000E-06 747 55 5.168000E+01 6.116000E-05 6.586000E-06 747 56 5.263000E+01 5.837000E-05 6.575000E-06 747 57 5.359000E+01 5.550000E-05 6.539000E-06 747 58 5.455000E+01 5.259000E-05 6.477000E-06 747 59 5.550000E+01 4.968000E-05 6.393000E-06 747 60 5.646000E+01 4.680000E-05 6.293000E-06 747 61 5.742000E+01 4.398000E-05 6.184000E-06 747 62 5.838000E+01 4.124000E-05 6.076000E-06 747 63 5.933000E+01 3.860000E-05 5.979000E-06 747 64 6.029000E+01 3.605000E-05 5.898000E-06 747 65 6.125000E+01 3.361000E-05 5.837000E-06 747 66 6.220000E+01 3.124000E-05 5.789000E-06 747 67 6.316000E+01 2.894000E-05 5.744000E-06 747 68 6.412000E+01 2.667000E-05 5.683000E-06 747 69 6.507000E+01 2.440000E-05 5.581000E-06 747 70 6.603000E+01 2.207000E-05 5.411000E-06 747 71 6.699000E+01 1.964000E-05 5.143000E-06 747 72 6.795000E+01 1.706000E-05 4.749000E-06 747 73 6.890000E+01 1.427000E-05 4.201000E-06 747 74 6.986000E+01 1.122000E-05 3.472000E-06 747 75 7.082000E+01 7.852000E-06 2.541000E-06 747 76 7.177000E+01 4.126000E-06 1.389000E-06 747 77 7.273000E+01 0.000000E+00 0.000000E+00 # loop_ _sas_p_of_R_extrapolated_intensity.id _sas_p_of_R_extrapolated_intensity.ordinal _sas_p_of_R_extrapolated_intensity.momentum_transfer _sas_p_of_R_extrapolated_intensity.intensity_reg 747 1 0.000000E+00 4.250450E-02 747 2 1.246750E-03 4.248640E-02 747 3 2.493500E-03 4.243200E-02 747 4 3.740250E-03 4.234160E-02 747 5 4.987000E-03 4.221520E-02 747 6 6.233750E-03 4.205320E-02 747 7 7.480500E-03 4.185610E-02 747 8 8.727250E-03 4.162410E-02 747 9 9.974000E-03 4.135790E-02 747 10 1.130000E-02 4.103780E-02 747 11 1.263000E-02 4.067940E-02 747 12 1.396000E-02 4.028440E-02 747 13 1.529000E-02 3.985390E-02 747 14 1.662000E-02 3.938900E-02 747 15 1.795000E-02 3.889080E-02 747 16 1.928000E-02 3.836070E-02 747 17 2.061000E-02 3.779990E-02 747 18 2.194000E-02 3.720980E-02 747 19 2.327000E-02 3.659200E-02 747 20 2.460000E-02 3.594780E-02 747 21 2.593000E-02 3.527900E-02 747 22 2.726000E-02 3.458710E-02 747 23 2.859000E-02 3.387380E-02 747 24 2.991000E-02 3.314630E-02 747 25 3.124000E-02 3.239540E-02 747 26 3.257000E-02 3.162820E-02 747 27 3.390000E-02 3.084640E-02 747 28 3.523000E-02 3.005200E-02 747 29 3.656000E-02 2.924660E-02 747 30 3.788000E-02 2.843810E-02 747 31 3.921000E-02 2.761610E-02 747 32 4.054000E-02 2.678840E-02 747 33 4.187000E-02 2.595680E-02 747 34 4.197000E-02 2.589420E-02 747 35 4.320000E-02 2.512290E-02 747 36 4.452000E-02 2.429480E-02 747 37 4.585000E-02 2.346150E-02 747 38 4.596000E-02 2.339260E-02 747 39 4.718000E-02 2.263080E-02 747 40 4.850000E-02 2.181060E-02 747 41 4.983000E-02 2.098990E-02 747 42 4.996000E-02 2.091000E-02 747 43 5.116000E-02 2.017640E-02 747 44 5.248000E-02 1.937760E-02 747 45 5.381000E-02 1.858250E-02 747 46 5.394000E-02 1.850540E-02 747 47 5.793000E-02 1.619640E-02 747 48 6.192000E-02 1.401960E-02 747 49 6.590000E-02 1.200480E-02 747 50 6.988000E-02 1.016440E-02 747 51 7.386000E-02 8.510630E-03 747 52 7.783000E-02 7.052750E-03 747 53 8.181000E-02 5.783670E-03 747 54 8.578000E-02 4.704850E-03 747 55 8.975000E-02 3.803540E-03 747 56 9.371000E-02 3.068400E-03 747 57 9.768000E-02 2.480000E-03 747 58 1.016000E-01 2.027720E-03 747 59 1.056000E-01 1.679260E-03 747 60 1.095000E-01 1.431040E-03 747 61 1.135000E-01 1.251810E-03 747 62 1.174000E-01 1.133660E-03 747 63 1.214000E-01 1.054670E-03 747 64 1.253000E-01 1.005390E-03 747 65 1.293000E-01 9.716070E-04 747 66 1.332000E-01 9.459380E-04 747 67 1.371000E-01 9.206780E-04 747 68 1.410000E-01 8.911640E-04 747 69 1.449000E-01 8.545790E-04 747 70 1.489000E-01 8.084500E-04 747 71 1.528000E-01 7.551990E-04 747 72 1.567000E-01 6.949100E-04 747 73 1.606000E-01 6.293990E-04 747 74 1.645000E-01 5.608750E-04 747 75 1.683000E-01 4.934460E-04 747 76 1.722000E-01 4.257620E-04 747 77 1.761000E-01 3.615830E-04 747 78 1.800000E-01 3.024990E-04 747 79 1.838000E-01 2.508990E-04 747 80 1.877000E-01 2.046840E-04 747 81 1.915000E-01 1.663640E-04 747 82 1.954000E-01 1.336530E-04 747 83 1.992000E-01 1.076340E-04 747 84 2.031000E-01 8.607320E-05 747 85 2.069000E-01 6.908970E-05 747 86 2.107000E-01 5.505510E-05 747 87 2.145000E-01 4.298870E-05 747 88 2.184000E-01 3.173520E-05 747 89 2.222000E-01 2.114640E-05 747 90 2.260000E-01 1.041510E-05 747 91 2.297000E-01 -4.497260E-07 747 92 2.335000E-01 -1.210950E-05 747 93 2.373000E-01 -2.416460E-05 747 94 2.411000E-01 -3.633490E-05 747 95 2.448000E-01 -4.791460E-05 747 96 2.486000E-01 -5.906870E-05 747 97 2.523000E-01 -6.874510E-05 747 98 2.561000E-01 -7.701240E-05 747 99 2.598000E-01 -8.306410E-05 747 100 2.635000E-01 -8.687470E-05 747 101 2.673000E-01 -8.830280E-05 747 102 2.710000E-01 -8.725770E-05 747 103 2.747000E-01 -8.393270E-05 #