{
  "code": "SASDXD4",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Structural dynamics of IDR interactions in human SFPQ and implications for liquid–liquid phase separation",
    "publication": {
      "title": "Structural dynamics of IDR interactions in human SFPQ and implications for liquid–liquid phase separation",
      "author_list": "Koning H, Lai V, Sethi A, Chakraborty S, Ang C, Fox A, Duff A, Whitten A, Marshall A, Bond C",
      "journal": "Acta Crystallographica Section D Structural Biology",
      "doi": "10.1107/S2059798325005303",
      "pmid": null,
      "published_date": "2025 Jun 27"
    },
    "status": "released",
    "submitted_date": "2024-09-18",
    "released_date": "2025-06-29"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDXD4.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXD4.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXD4_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXD4_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDXD4_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXD4_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXD4.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "ORDELA/21000N",
        "resolution": 5.1
      },
      "name": "Australian Centre for Neutron Scattering (ANSTO)",
      "city": "Lucas Heights, Sydney",
      "country": "Australia",
      "beamline_name": "Quokka - Small Angle Neutron Scattering",
      "beam_geometry": null,
      "type_of_source": "neutron source",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Splicing factor, proline- and glutamine-rich",
          "short_name": "SFPQ cysteine dimer",
          "sequence": "GAMSRDRFRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPIPPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPGVGSAPPASSSAPPATPPTSGAPPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQAGGPPPPPAAVPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGEPRGGRQHHPPYHQQHHQGPPPGGPGGRSEEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQLRVRFATHAAALSVRNLSPYVSNELLEEAFSQFGPIERAVVIVDDRGRSTGKGIVEFASKPAARKAFERCSEGVFLLTTTPRPVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEYSQRWKSLDEMEKQQREQVEKNMKDAKDKLESEMEDAYHEHQANLLRQDLMRRQEELRRMEELHNQEMQKRKEMQLRQEEERRRREEEMMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF",
          "organism": "Homo sapiens",
          "uniprot_code": "P23246",
          "uniprot_range_first": 214,
          "uniprot_range_last": 707,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSRDRFRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPI\nPPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPG\nVGSAPPASSSAPPATPPTSGAPPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQ\nAGGPPPPPAAVPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE\nPRGGRQHHPPYHQQHHQGPPPGGPGGRSEEKISDSEGFKANLSLLRRPGEKTYTQRCRLF\nVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGR\nQLRVRFATHAAALSVRNLSPYVSNELLEEAFSQFGPIERAVVIVDDRGRSTGKGIVEFAS\nKPAARKAFERCSEGVFLLTTTPRPVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRF\nAQHGTFEYEYSQRWKSLDEMEKQQREQVEKNMKDAKDKLESEMEDAYHEHQANLLRQDLM\nRRQEELRRMEELHNQEMQKRKEMQLRQEEERRRREEEMMIRQREMEEQMRRQREESYSRM\nGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGS\nDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF",
          "mw": 76.277,
          "total_mw": 152.554,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "R542C mutation causes monomers of SFPQ to dimerise via the coiled-coil domain (Lee et al, 2015)"
        }
      ],
      "buffer": {
        "name": "150 mM KCl, 1.5% glycerol, 20 mM HEPES, 1 mM DTT (in 100% H2O)",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.4,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Full-length human SFPQ dimer (protiated and deuterated)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "The University of Western Australia",
            "webpage": null
          }
        ],
        "contributor_name": "Heidar",
        "contributor_surname": "Koning",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2023-01-23",
    "storage_temperature": 25.0,
    "cell_temperature": 25.0,
    "exposure_time": 7200.0,
    "number_of_frames": null,
    "wavelength": 0.6,
    "sample_detector_distance": 1.3,
    "concentration_min": null,
    "concentration_max": 0.63,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.082,
    "s_max": 4.352,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "An experiment on a mixture of protiated (0.03 mg/ml) and deuterated (0.6 mg/ml) dimers of full-length SFPQ. 600 uL of sample was in 150 mM KCl, 1.5% glycerol, 20 mM HEPES, 1 mM DTT, pH 7.4 (100% H2O) and scattering was collected at QUOKKA ANSTO Lucas Heights. \r\n\r\nThis data is part of the manuscript 'Structural dynamics of IDR interactions in human SFPQ and implications for liquid-liquid phase separation'",
  "experiment_description": null,
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 197.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.233,
  "pddf_i0_error": 0.078,
  "guinier_i0": 0.238176,
  "guinier_i0_error": null,
  "pddf_rg": 8.6,
  "pddf_rg_error": 0.39,
  "guinier_rg": 8.655,
  "guinier_rg_error": 5.862,
  "pddf_dmax": 30.7,
  "pddf_dmax_error": null,
  "porod_volume": 241000.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 11,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDXD4_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-07-03T11:05:26.692742+02:00",
  "bragg_peak": []
}