{ "code": "SASDBE3", "status": "Published", "type_of_curve": "Single concentration", "angular_unit": "1/nm", "project": { "title": "Insights on the structural dynamics of Leishmania braziliensis Hsp90 molecular chaperone by small angle X-ray scattering.", "publication": { "title": "Insights on the structural dynamics of Leishmania braziliensis Hsp90 molecular chaperone by small angle X-ray scattering.", "author_list": "Seraphim TV, Silva KP, Dores-Silva PR, Barbosa LR, Borges JC", "journal": "Int J Biol Macromol", "doi": "10.1016/j.ijbiomac.2017.01.058", "pmid": "28104372", "published_date": "2017 Apr" }, "status": "released", "submitted_date": "2016-01-18", "released_date": "2016-01-21" }, "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBE3.out", "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBE3.dat", "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBE3_dat_img.png", "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBE3_kratky_img.png", "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBE3_pofr_img.png", "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBE3_guinier_img.png", "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBE3.sascif", "experiment": { "instrument": { "detector": { "type": null, "name": "MAR 165 CCD", "resolution": null }, "name": "Brazilian Synchrotron Light Laboratory", "city": "Campinas", "country": "Brazil", "beamline_name": "SAXS2 Beamline", "beam_geometry": "", "type_of_source": "X-ray synchrotron", "point_source": null, "line_collimation": null, "sample_path_length": null, "line_collimation_slitlength": null, "line_collimation_integrationwidth": null, "xray_energy": null, "beam_profile_ah": null, "beam_profile_al": null }, "sample": { "molecule": [ { "long_name": "Leishmania braziliensis heat shock protein 90 (Hsp90) N domain", "short_name": "L. brazilien.Hsp90N", "sequence": "GSHMTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKIRYQSLTDPSVLGEETHLRVRVVP\r\nDKANKTLTVEDNGIGMTKADLVNNLGTIARSGTKAFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVVS\r\nKNNSDEAYVWESSAGGTFTITSVPESDMKRGTRITLHLKEDQQEYLEERRVKELIKKHSEFIGYDIELMV\r\nEKTAEKEVTDEDEE", "organism": "Leishmania braziliensis", "uniprot_code": null, "uniprot_range_first": null, "uniprot_range_last": null, "oligomerization": "monomer", "molecular_type": "protein", "uniprot_sequence": null, "mw": 26.0, "total_mw": 26.0, "number_molecules": 1, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null } ], "buffer": { "name": "25 Tris mM 100 mM NaCl 1 mM 2-mercaptoethanol", "concentration_unit": "mM", "comment": null, "additive": "100 mM NaCl, 1 mM 2-mercaptoethanol", "concentration": 25.0, "pka": null, "ph": 7.5, "deuteration": null }, "purity_method": null, "name": "Leishmania braziliensis heat shock protein 90 (Hsp90) N domain.", "ext_coefficient": null, "contrast": null, "specific_vol": null, "dry_vol": null, "absorbption": null, "deuteration": null, "mixture": null }, "contributor": [ { "affiliation": [ { "short_name": null, "address": "São Paulo, SP, Brazil", "full_name": "Instituto de Física, Universidade de São Paulo", "webpage": "" } ], "contributor_name": "Leandro", "contributor_surname": "Barbosa", "orcid": null }, { "affiliation": [ { "short_name": null, "address": "São Carlos - SP - Brasil", "full_name": "Instituto de Química de São Carlos", "webpage": "" } ], "contributor_name": "Júlio", "contributor_surname": "Borges", "orcid": null }, { "affiliation": [ { "short_name": null, "address": "São Carlos - SP - Brasil", "full_name": "Instituto de Química de São Carlos", "webpage": "" } ], "contributor_name": "Paulo", "contributor_surname": "Dores-Silva", "orcid": null }, { "affiliation": [ { "short_name": null, "address": "São Carlos - SP - Brasil", "full_name": "Instituto de Química de São Carlos", "webpage": "" } ], "contributor_name": "Thiago", "contributor_surname": "Seraphim", "orcid": null }, { "affiliation": [ { "short_name": null, "address": "São Carlos - SP - Brasil", "full_name": "Instituto de Química de São Carlos", "webpage": "" } ], "contributor_name": "Kelly", "contributor_surname": "Silva", "orcid": null } ], "concentration_method": null, "concentration_unit": null, "date": "2011-09-01", "storage_temperature": null, "cell_temperature": null, "exposure_time": null, "number_of_frames": null, "wavelength": null, "sample_detector_distance": null, "concentration_min": null, "concentration_max": null, "sample_volume": null, "flow_rate": null, "s_min": 0.191, "s_max": 3.297, "total_exposure_time": null, "seccolumn": null }, "fits": [ { "models": [ { "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBE3_fit1_model1_img.png", "software": "DAMMIN", "pdb_link": [], "model_title": null, "type_of_model": "dummy", "software_version": "", "model_data": "https://www.sasbdb.org/media/pdb_file/SASDBE3_fit1_model1.pdb", "model_mw": 23.965, "bead_radius": 1.9, "log": null, "symmetry": "", "comment": "", "user": 161 } ], "fit_unit": "1/A", "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBE3_fit1_fit_img.png", "software": null, "chi_square_value": 2.238, "p_value": 0.026061, "fit_residual_plot": "SASDBE3_fit1_fitresiduals_img.png", "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBE3_fit1.fit", "fit_log": null, "software_version": "", "description": null } ], "estimated_volume_method": null, "pddf_software": "ATSAS GNOM", "pddf_software_version": null, "i0_calibration_standard": null, "description": null, "experiment_description": "X-ray synchrotron radiation scattering data from solutions of Leishmania braziliensis heat shock protein 90 (Hsp90) N domain in 25 mM Tris 100 mM NaCl, 1 mM 2-mercaptoethanol were collected on the SAXS2 Beamline camera on the storage ring Brazilian Synchrotron Light Laboratory (Campinas, Brazil) using a MAR Image Plate detector (s = 4π sin θ/λ, where 2θ is the scattering angle). The data were normalized to the intensity of the transmitted beam and radially averaged. The scattering of the solvent-blank was subtracted. The low angle data collected were obtained from a single concentration scattering curve. ", "tags": [], "intensity_unit": null, "experimental_mw": 28.0, "experimental_mw_error": null, "guinier_i0_mw": null, "guinier_i0_mw_error": null, "porod_mw": null, "porod_mw_error": null, "pddf_i0": 0.02895, "pddf_i0_error": null, "guinier_i0": 2.9e-06, "guinier_i0_error": null, "pddf_rg": 2.05, "pddf_rg_error": null, "guinier_rg": 2.02, "guinier_rg_error": null, "pddf_dmax": 7.5, "pddf_dmax_error": null, "porod_volume": 40.0, "porod_volume_error": null, "estimated_volume": null, "estimated_volume_error": null, "guinier_point_first": 4, "guinier_point_last": 32, "pddf_point_first": null, "pddf_point_last": null, "i0_calibration_standard_data": null, "intensities_log_log_plot": "SASDBE3_datloglog_img.png", "symmetry": null, "last_modified": "2019-12-06T13:07:15.624532+01:00", "bragg_peak": [] }