{
  "code": "SASDYE7",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Structural basis of FatB-mediated iron uptake via tyrosine/histidine direct coordination accompanying long-distance domain reorganization.",
    "publication": {
      "title": "Structural basis of FatB-mediated iron uptake via tyrosine/histidine direct coordination accompanying long-distance domain reorganization.",
      "author_list": "Lee H, Kim SO, You S, Segalina A, Noh T, Ihee H",
      "journal": "Nat Commun",
      "doi": "10.1038/s41467-026-72127-y",
      "pmid": "42000734",
      "published_date": "2026 Apr 18"
    },
    "status": "released",
    "submitted_date": "2026-02-19",
    "released_date": "2026-04-02"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDYE7.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDYE7.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDYE7_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDYE7_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDYE7_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDYE7_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDYE7.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Dectris / EIGER2 X 4M",
        "resolution": 0.075
      },
      "name": "Pohang Accelerator Laboratory",
      "city": "Pohang",
      "country": "South Korea",
      "beamline_name": "4C",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Ferric anguibactin-binding protein",
          "short_name": "FatB",
          "sequence": "SDKPKTVEITDAHGTVKVPVNPKNVVALDNRTFETLSDWGIKLAAAPKDIMPADSAYKKDEKVQNIGNHREPNLEIIAAANPELVIVGQRFADHYEEIKKLVPNAAVIDLNFDVSEKATKPGENLVKGLKDSTVTLGKIFNKDKEAKQLVADFDKSIEKAKSAYNGKDKVMSVIVTGGNIGFAAPHSGRVWGPMYEIFGWTPALEVSNSTAGHKGDDVSVEAIAQTNPDWIFVLDRDAATSDAAKSTPAKDVISKSPALQNTTAVSKKQVIYAPEDTYTNESIQTYIELFGNMAKTLAK",
          "organism": "Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)",
          "uniprot_code": "Q815N5",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MKKSMLLKLVSILAVFTLMLVACSDSSKETSKANNKDNGSDKPKTVEITDAHGTVKVPVN\nPKNVVALDNRTFETLSDWGIKLAAAPKDIMPADSAYKKDEKVQNIGNHREPNLEIIAAAN\nPELVIVGQRFADHYEEIKKLVPNAAVIDLNFDVSEKATKPGENLVKGLKDSTVTLGKIFN\nKDKEAKQLVADFDKSIEKAKSAYNGKDKVMSVIVTGGNIGFAAPHSGRVWGPMYEIFGWT\nPALEVSNSTAGHKGDDVSVEAIAQTNPDWIFVLDRDAATSDAAKSTPAKDVISKSPALQN\nTTAVSKKQVIYAPEDTYTNESIQTYIELFGNMAKTLAK",
          "mw": 32.425,
          "total_mw": 32.425,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "SAXS data of FePBvFatB were collected at two sample-to-detector distances (3 m and 1 m). The 3 m setting covered the low-q region (q ≈ 0.025 to 0.126 Å-1), and the 1 m setting covered the higher-q region (q ≈ 0.126 to 0.60 Å-1). The datasets were scaled and checked for agreement in the overlap region before merging into a single profile."
        }
      ],
      "buffer": {
        "name": "20mM Tris-HCl, 100 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Ferric anguibactin-binding protein in complex with the ferric petrobactin photoproduct (FePBv-FatB)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2025-04-07",
    "storage_temperature": 4.0,
    "cell_temperature": 4.0,
    "exposure_time": 10.0,
    "number_of_frames": 50,
    "wavelength": 0.0734,
    "sample_detector_distance": 3.0,
    "concentration_min": null,
    "concentration_max": 3.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.25,
    "s_max": 6.002,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "SAXS data of FePBvFatB were collected at two sample-to-detector distances (3 m and 1 m). The 3 m setting covered the low-q region (q ≈ 0.025 to 0.126 Å-1), and the 1 m setting covered the higher-q region (q ≈ 0.126 to 0.60 Å-1). The datasets were scaled and checked for agreement in the overlap region before merging into a single profile.",
  "experiment_description": null,
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 33.1,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 35.0,
  "porod_mw_error": null,
  "pddf_i0": 77.06,
  "pddf_i0_error": null,
  "guinier_i0": 76.789,
  "guinier_i0_error": null,
  "pddf_rg": 2.15,
  "pddf_rg_error": null,
  "guinier_rg": 2.129,
  "guinier_rg_error": 0.028,
  "pddf_dmax": 7.13,
  "pddf_dmax_error": null,
  "porod_volume": 57.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 6,
  "guinier_point_last": 180,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDYE7_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2026-04-24T10:30:31.657971+02:00",
  "bragg_peak": []
}