data_SASDCF9_MAIN # _sas_result.id 750 _sas_result.SASBDB_code SASDCF9 _sas_result.experimental_MW 142.000 _sas_result.experimental_MW_error . _sas_result.MW_standard . _sas_result.MW_standard_error . _sas_result.MW_Porod . _sas_result.MW_Porod_error . _sas_result.I0_from_PR 0.5787000000 _sas_result.I0_from_PR_error 0.0057000000 _sas_result.I0_from_Guinier 0.6000000000 _sas_result.I0_from_Guinier_error 0.0030000000 _sas_result.Rg_from_PR 3.439 _sas_result.Rg_from_PR_error 0.060 _sas_result.Rg_from_Guinier 3.549 _sas_result.Rg_from_Guinier_error 0.314 _sas_result.D_max 12.50 _sas_result.Porod_volume . _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min 1 _sas_result.Guinier_point_max 83 _sas_result.type_of_curve single_conc _sas_result.standard . _sas_result.Dmax_error . _sas_result.comments "Additional SANS measurement parameters. Three detector positions (in m) and count times (s) were employed: 1 m (two frames of 300 + 900 = 1200 s total count time); 4 m (two frames of 1800 + 1800 = 3600 s total count time); 13 m (two frames of 300 + 1200 = 1500 s total count time)." # _sas_scan.title "Nanolipoprotein Particle (NLP) from Cell-Free Expression - 100% D2O SANS" _sas_scan.detc_id 43 _sas_scan.id 750 _sas_scan.measurement_date 2015-11-25 _sas_scan.storage_temperature 4.0 _sas_scan.cell_temperature 20.0 _sas_scan.exposure_time 1800.000 _sas_scan.number_of_frames 2 _sas_scan.unit 1/A _sas_scan.qmin 0.0039 _sas_scan.qmax 0.5936 _sas_scan.sample_id 710 _sas_scan.result_id 750 _sas_scan.beam_id 64 # _sas_beam.id 64 _sas_beam.instrument_name "NIST Center for Neutron Research NG7" _sas_beam.instrument_city "Gaithersburg, MD" _sas_beam.instrument_country USA _sas_beam.shape . _sas_beam.type_of_source "neutron source" _sas_beam.radiation_wavelength 0.600000 _sas_beam.dist_spec_to_detc 4.00000 # _sas_detc.id 43 _sas_detc.name "Ordela 2660N" _sas_detc.type "640x640 mm 3He posn sensitive prop counter" _sas_detc.pixsize_x 5.080 # _sas_sample.id 710 _sas_sample.name "Nanolipoprotein Particle (NLP) from Cell-Free Expression - 100% D2O SANS" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration 0.90 _sas_sample.concentration_method . loop_ _sas_sample.entity_id 862 866 # _sas_buffer.id 428 _sas_buffer.name "PBS in D2O" _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.400 _sas_buffer.comment "8 g/L NaCl, 0.2 g/L KH2PO4, 1.15 g/L Na2HPO4, 0.2 g/L KCl, in D2O with no additional pH adjustment" _sas_buffer.composition . _sas_buffer.sample_id 710 # loop_ _entity.id _entity.type _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules 862 other 1,2-dimyristoyl-sn-glycero-3-phosphocholine 0.678 . 866 protein "Apolipoprotein A-I" 26.068 2 # loop_ _entity_name_com.entity_id _entity_name_com.name 862 DMPC 866 ApoA-I # loop_ _entity_poly.entity_id _entity_poly.pdbx_seq_one_letter_code 862 N/A 866 MSGSHHHHHHSSGIEGRGRLIKHMLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTKAQSVIDKASETLTAQGSG # loop_ _entity_src_gen.entity_id _entity_src_gen.gene_src_common_name 862 . 866 "Mus musculus" # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code 1 862 UniProt . 2 866 UniProt Q00623 _struct_ref.details http://www.uniprot.org/uniprot/Q00623 # _citation.id 305 _citation.title "Small-angle X-ray and neutron scattering demonstrates that cell-free expression produces properly formed disc-shaped nanolipoprotein particles." _citation.year "2017 Dec 20" _citation.pdbx_database_id_DOI 10.1002/pro.3365 _citation.pdbx_database_id_PubMed 29266475 # loop_ _citation_author.citation_id _citation_author.ordinal _citation_author.name 305 1 "Cleveland TE 4th" 305 2 "He W" 305 3 "Evans AC" 305 4 "Fischer NO" 305 5 "Lau EY" 305 6 "Coleman MA" # _pdbx_contact_author.id 197 _pdbx_contact_author.name_first Thomas _pdbx_contact_author.name_last Cleveland _pdbx_contact_author.role . _pdbx_contact_author.address_1 . _pdbx_contact_author.address_2 "National Institute of Standards and Technology, Gaithersburg, MD, USA" _pdbx_contact_author.address_3 . # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 3.887000E-03 6.768960E-01 1.916000E-01 750 2 4.297000E-03 5.849960E-01 1.495000E-01 750 3 4.706000E-03 5.475960E-01 1.494000E-01 750 4 5.115000E-03 5.574960E-01 1.281000E-01 750 5 5.524000E-03 6.615960E-01 9.954000E-02 750 6 5.934000E-03 6.502960E-01 8.335000E-02 750 7 6.343000E-03 5.318960E-01 8.529000E-02 750 8 6.752000E-03 5.509960E-01 7.896000E-02 750 9 7.161000E-03 5.388960E-01 7.914000E-02 750 10 7.570000E-03 6.450960E-01 6.487000E-02 750 11 7.979000E-03 6.123960E-01 6.717000E-02 750 12 8.389000E-03 5.122960E-01 5.255000E-02 750 13 8.798000E-03 6.330960E-01 4.931000E-02 750 14 9.207000E-03 4.139960E-01 5.559000E-02 750 15 9.616000E-03 6.406960E-01 5.615000E-02 750 16 1.003000E-02 6.355960E-01 5.108000E-02 750 17 1.043000E-02 5.995960E-01 4.218000E-02 750 18 1.084000E-02 4.742960E-01 4.707000E-02 750 19 1.125000E-02 5.714960E-01 4.201000E-02 750 20 1.166000E-02 5.565960E-01 3.881000E-02 750 21 1.207000E-02 5.378960E-01 4.491000E-02 750 22 1.248000E-02 5.584960E-01 4.173000E-02 750 23 1.263000E-02 5.723960E-01 1.043000E-02 750 24 1.289000E-02 6.104960E-01 3.856000E-02 750 25 1.330000E-02 5.773960E-01 3.730000E-02 750 26 1.371000E-02 5.587960E-01 3.448000E-02 750 27 1.396000E-02 5.554960E-01 8.063000E-03 750 28 1.412000E-02 4.909960E-01 3.944000E-02 750 29 1.453000E-02 6.004960E-01 3.579000E-02 750 30 1.494000E-02 4.706960E-01 4.001000E-02 750 31 1.529000E-02 5.428960E-01 8.014000E-03 750 32 1.534000E-02 5.535960E-01 3.100000E-02 750 33 1.575000E-02 5.138960E-01 3.309000E-02 750 34 1.616000E-02 4.856960E-01 3.756000E-02 750 35 1.657000E-02 5.462960E-01 3.140000E-02 750 36 1.662000E-02 5.245960E-01 7.304000E-03 750 37 1.698000E-02 5.318960E-01 3.361000E-02 750 38 1.739000E-02 5.362960E-01 3.063000E-02 750 39 1.780000E-02 5.743960E-01 3.107000E-02 750 40 1.795000E-02 5.208960E-01 7.491000E-03 750 41 1.821000E-02 5.421960E-01 2.701000E-02 750 42 1.862000E-02 5.194960E-01 3.048000E-02 750 43 1.903000E-02 4.969960E-01 2.872000E-02 750 44 1.928000E-02 5.012960E-01 7.096000E-03 750 45 1.944000E-02 4.939960E-01 2.943000E-02 750 46 1.984000E-02 5.067960E-01 2.860000E-02 750 47 2.025000E-02 5.049960E-01 2.700000E-02 750 48 2.061000E-02 5.026960E-01 6.326000E-03 750 49 2.066000E-02 4.822960E-01 2.614000E-02 750 50 2.107000E-02 4.568960E-01 2.879000E-02 750 51 2.148000E-02 4.885960E-01 2.745000E-02 750 52 2.189000E-02 5.086960E-01 2.638000E-02 750 53 2.194000E-02 4.883960E-01 5.849000E-03 750 54 2.230000E-02 4.722960E-01 2.654000E-02 750 55 2.271000E-02 4.260960E-01 2.692000E-02 750 56 2.312000E-02 4.684960E-01 2.529000E-02 750 57 2.327000E-02 4.757960E-01 5.674000E-03 750 58 2.353000E-02 4.434960E-01 2.683000E-02 750 59 2.393000E-02 4.401960E-01 2.606000E-02 750 60 2.434000E-02 4.507960E-01 2.706000E-02 750 61 2.460000E-02 4.627960E-01 5.611000E-03 750 62 2.475000E-02 4.751960E-01 2.810000E-02 750 63 2.516000E-02 4.467960E-01 2.723000E-02 750 64 2.557000E-02 3.874960E-01 2.728000E-02 750 65 2.593000E-02 4.434960E-01 5.240000E-03 750 66 2.598000E-02 4.235960E-01 2.955000E-02 750 67 2.639000E-02 4.388960E-01 3.061000E-02 750 68 2.680000E-02 3.997960E-01 2.905000E-02 750 69 2.721000E-02 4.375960E-01 3.284000E-02 750 70 2.726000E-02 4.317960E-01 5.101000E-03 750 71 2.761000E-02 4.284960E-01 3.524000E-02 750 72 2.802000E-02 4.788960E-01 3.022000E-02 750 73 2.843000E-02 4.456960E-01 3.700000E-02 750 74 2.859000E-02 4.231960E-01 4.605000E-03 750 75 2.884000E-02 4.169960E-01 3.406000E-02 750 76 2.925000E-02 4.641960E-01 3.888000E-02 750 77 2.966000E-02 3.973960E-01 3.990000E-02 750 78 2.991000E-02 4.026960E-01 5.072000E-03 750 79 3.124000E-02 4.031960E-01 5.195000E-03 750 80 3.257000E-02 3.847960E-01 5.088000E-03 750 81 3.390000E-02 3.648960E-01 4.445000E-03 750 82 3.523000E-02 3.544960E-01 4.606000E-03 750 83 3.656000E-02 3.441960E-01 3.888000E-03 750 84 3.788000E-02 3.338960E-01 4.344000E-03 750 85 3.921000E-02 3.219960E-01 4.117000E-03 750 86 4.054000E-02 3.052960E-01 3.571000E-03 750 87 4.187000E-02 3.041960E-01 3.647000E-03 750 88 4.320000E-02 2.874960E-01 3.746000E-03 750 89 4.452000E-02 2.734960E-01 3.750000E-03 750 90 4.585000E-02 2.591960E-01 3.210000E-03 750 91 4.718000E-02 2.492960E-01 3.484000E-03 750 92 4.850000E-02 2.321960E-01 3.355000E-03 750 93 4.983000E-02 2.335960E-01 3.409000E-03 750 94 5.116000E-02 2.169960E-01 3.251000E-03 750 95 5.248000E-02 2.135960E-01 3.172000E-03 750 96 5.381000E-02 2.018960E-01 3.302000E-03 750 97 5.514000E-02 1.899960E-01 2.970000E-03 750 98 5.646000E-02 1.844960E-01 2.815000E-03 750 99 5.779000E-02 1.681960E-01 2.892000E-03 750 100 5.911000E-02 1.633960E-01 2.907000E-03 750 101 6.044000E-02 1.521960E-01 2.720000E-03 750 102 6.176000E-02 1.430960E-01 2.643000E-03 750 103 6.309000E-02 1.374960E-01 2.458000E-03 750 104 6.441000E-02 1.311960E-01 2.464000E-03 750 105 6.573000E-02 1.201960E-01 2.455000E-03 750 106 6.706000E-02 1.148960E-01 2.482000E-03 750 107 6.838000E-02 1.064960E-01 2.553000E-03 750 108 6.971000E-02 1.029960E-01 2.438000E-03 750 109 7.103000E-02 9.439600E-02 2.388000E-03 750 110 7.235000E-02 8.319600E-02 2.598000E-03 750 111 7.367000E-02 7.909600E-02 2.304000E-03 750 112 7.500000E-02 7.579600E-02 2.261000E-03 750 113 7.632000E-02 7.639600E-02 2.354000E-03 750 114 7.764000E-02 6.259600E-02 2.326000E-03 750 115 7.896000E-02 6.299600E-02 2.300000E-03 750 116 8.028000E-02 5.849600E-02 2.162000E-03 750 117 8.161000E-02 4.919600E-02 2.238000E-03 750 118 8.227000E-02 5.129600E-02 1.284000E-03 750 119 8.293000E-02 4.769600E-02 2.301000E-03 750 120 8.425000E-02 4.379600E-02 2.527000E-03 750 121 8.557000E-02 4.219600E-02 2.546000E-03 750 122 8.689000E-02 3.859600E-02 2.525000E-03 750 123 8.755000E-02 3.889600E-02 1.169000E-03 750 124 8.821000E-02 3.839600E-02 2.948000E-03 750 125 8.952000E-02 3.446600E-02 3.105000E-03 750 126 9.084000E-02 3.371600E-02 2.887000E-03 750 127 9.216000E-02 3.281600E-02 2.984000E-03 750 128 9.282000E-02 2.848600E-02 1.099000E-03 750 129 9.348000E-02 2.938600E-02 3.161000E-03 750 130 9.480000E-02 2.343600E-02 3.285000E-03 750 131 9.612000E-02 3.397600E-02 3.585000E-03 750 132 9.809000E-02 2.124600E-02 1.145000E-03 750 133 1.034000E-01 1.582600E-02 1.069000E-03 750 134 1.086000E-01 1.114600E-02 9.223000E-04 750 135 1.139000E-01 8.276000E-03 9.196000E-04 750 136 1.191000E-01 6.886000E-03 9.708000E-04 750 137 1.244000E-01 6.016000E-03 9.854000E-04 750 138 1.296000E-01 5.156000E-03 8.243000E-04 750 139 1.348000E-01 3.966000E-03 8.944000E-04 750 140 1.400000E-01 3.876000E-03 9.192000E-04 750 141 1.452000E-01 3.886000E-03 7.479000E-04 750 142 1.504000E-01 1.466000E-03 8.609000E-04 750 143 1.556000E-01 2.256000E-03 8.018000E-04 750 144 1.608000E-01 5.060000E-04 8.185000E-04 750 145 1.660000E-01 2.226000E-03 8.030000E-04 750 146 1.712000E-01 2.286000E-03 7.890000E-04 750 147 1.763000E-01 1.486000E-03 7.292000E-04 750 148 1.815000E-01 1.646000E-03 7.146000E-04 750 149 1.866000E-01 2.146000E-03 7.203000E-04 750 150 1.917000E-01 1.826000E-03 7.591000E-04 750 151 1.968000E-01 6.860000E-04 7.372000E-04 750 152 2.019000E-01 1.616000E-03 7.873000E-04 750 153 2.070000E-01 1.626000E-03 6.605000E-04 750 154 2.121000E-01 1.216000E-03 6.819000E-04 750 155 2.172000E-01 1.066000E-03 6.561000E-04 750 156 2.223000E-01 1.816000E-03 6.385000E-04 750 157 2.273000E-01 5.060000E-04 6.800000E-04 750 158 2.323000E-01 1.386000E-03 7.511000E-04 750 159 2.374000E-01 9.060000E-04 6.337000E-04 750 160 2.424000E-01 1.236000E-03 5.876000E-04 750 161 2.474000E-01 6.600000E-05 6.586000E-04 750 162 2.524000E-01 -5.440000E-04 6.715000E-04 750 163 2.573000E-01 6.560000E-04 6.391000E-04 750 164 2.623000E-01 1.376000E-03 6.163000E-04 750 165 2.672000E-01 1.096000E-03 6.610000E-04 750 166 2.722000E-01 1.556000E-03 6.000000E-04 750 167 2.771000E-01 3.260000E-04 6.313000E-04 750 168 2.820000E-01 1.976000E-03 5.859000E-04 750 169 2.869000E-01 3.560000E-04 6.518000E-04 750 170 2.917000E-01 1.076000E-03 6.203000E-04 750 171 2.966000E-01 1.376000E-03 6.306000E-04 750 172 3.015000E-01 1.446000E-03 6.484000E-04 750 173 3.063000E-01 -8.400000E-05 5.623000E-04 750 174 3.111000E-01 -7.240000E-04 6.466000E-04 750 175 3.159000E-01 7.060000E-04 6.397000E-04 750 176 3.207000E-01 -2.540000E-04 6.253000E-04 750 177 3.254000E-01 -1.140000E-04 6.587000E-04 750 178 3.302000E-01 4.560000E-04 7.487000E-04 750 179 3.349000E-01 1.436000E-03 6.947000E-04 750 180 3.397000E-01 -4.400000E-05 6.416000E-04 750 181 3.444000E-01 -1.440000E-04 7.102000E-04 750 182 3.490000E-01 5.560000E-04 7.489000E-04 750 183 3.537000E-01 2.560000E-04 6.801000E-04 750 184 3.584000E-01 6.860000E-04 7.346000E-04 750 185 3.630000E-01 3.860000E-04 7.557000E-04 750 186 3.676000E-01 -1.640000E-04 7.494000E-04 750 187 3.722000E-01 7.560000E-04 6.848000E-04 750 188 3.768000E-01 1.396000E-03 7.261000E-04 750 189 3.814000E-01 1.216000E-03 7.053000E-04 750 190 3.859000E-01 -8.140000E-04 7.312000E-04 750 191 3.905000E-01 5.560000E-04 7.007000E-04 750 192 3.950000E-01 6.060000E-04 7.251000E-04 750 193 3.995000E-01 -5.400000E-05 7.376000E-04 750 194 4.040000E-01 -1.084000E-03 7.489000E-04 750 195 4.084000E-01 -2.440000E-04 6.509000E-04 750 196 4.129000E-01 -7.440000E-04 8.111000E-04 750 197 4.173000E-01 7.360000E-04 7.948000E-04 750 198 4.217000E-01 -2.400000E-05 8.649000E-04 750 199 4.261000E-01 -1.054000E-03 7.022000E-04 750 200 4.305000E-01 4.460000E-04 7.534000E-04 750 201 4.348000E-01 -7.340000E-04 8.019000E-04 750 202 4.392000E-01 2.360000E-04 8.129000E-04 750 203 4.435000E-01 -8.140000E-04 6.781000E-04 750 204 4.478000E-01 1.686000E-03 7.827000E-04 750 205 4.521000E-01 -1.064000E-03 7.925000E-04 750 206 4.563000E-01 -6.140000E-04 7.365000E-04 750 207 4.606000E-01 3.600000E-05 8.126000E-04 750 208 4.648000E-01 -2.040000E-04 7.623000E-04 750 209 4.690000E-01 1.660000E-04 7.709000E-04 750 210 4.732000E-01 -1.464000E-03 8.534000E-04 750 211 4.774000E-01 -5.140000E-04 8.256000E-04 750 212 4.815000E-01 -5.340000E-04 8.478000E-04 750 213 4.856000E-01 -9.040000E-04 8.261000E-04 750 214 4.897000E-01 -2.814000E-03 7.711000E-04 750 215 4.938000E-01 -9.640000E-04 7.972000E-04 750 216 4.979000E-01 -1.004000E-03 8.039000E-04 750 217 5.020000E-01 -1.854000E-03 8.550000E-04 750 218 5.060000E-01 -2.034000E-03 7.499000E-04 750 219 5.100000E-01 1.160000E-04 8.577000E-04 750 220 5.140000E-01 -2.740000E-04 7.398000E-04 750 221 5.180000E-01 -7.440000E-04 7.955000E-04 750 222 5.220000E-01 -3.340000E-04 8.985000E-04 750 223 5.259000E-01 -1.400000E-05 8.810000E-04 750 224 5.298000E-01 -1.484000E-03 8.543000E-04 750 225 5.337000E-01 -2.404000E-03 8.062000E-04 750 226 5.376000E-01 -1.104000E-03 9.278000E-04 750 227 5.415000E-01 -7.440000E-04 1.020000E-03 750 228 5.453000E-01 -3.940000E-04 1.130000E-03 750 229 5.492000E-01 3.160000E-04 1.142000E-03 750 230 5.530000E-01 -7.640000E-04 1.233000E-03 750 231 5.568000E-01 -7.440000E-04 1.267000E-03 750 232 5.605000E-01 -1.634000E-03 1.449000E-03 750 233 5.643000E-01 -2.840000E-04 1.330000E-03 750 234 5.680000E-01 -1.294000E-03 1.388000E-03 750 235 5.717000E-01 3.600000E-05 2.009000E-03 750 236 5.754000E-01 -1.414000E-03 2.232000E-03 750 237 5.791000E-01 5.600000E-05 2.533000E-03 750 238 5.828000E-01 -2.864000E-03 2.112000E-03 750 239 5.864000E-01 2.686000E-03 3.383000E-03 750 240 5.900000E-01 -5.400000E-05 2.127000E-03 750 241 5.936000E-01 -1.574000E-03 3.955000E-03 750 # _sas_p_of_R_details.id 750 _sas_p_of_R_details.intensity_id 750 _sas_p_of_R_details.software_p_of_R "GNOM 5.0" _sas_p_of_R_details.number_of_points 156 _sas_p_of_R_details.qmin 0.003887 _sas_p_of_R_details.qmax 0.2223 _sas_p_of_R_details.p_of_R_point_min 1 _sas_p_of_R_details.p_of_R_point_max 156 _sas_p_of_R_details.Rmin 0.0 _sas_p_of_R_details.Rmax 124.7 # loop_ _sas_p_of_R.id _sas_p_of_R.ordinal _sas_p_of_R.r _sas_p_of_R.P _sas_p_of_R.P_error 750 1 0.000000E+00 0.000000E+00 0.000000E+00 750 2 1.272000E+00 1.378000E-05 8.317000E-06 750 3 2.544000E+00 3.027000E-05 1.301000E-05 750 4 3.816000E+00 4.954000E-05 1.438000E-05 750 5 5.089000E+00 7.175000E-05 1.292000E-05 750 6 6.361000E+00 9.705000E-05 9.259000E-06 750 7 7.633000E+00 1.256000E-04 4.237000E-06 750 8 8.905000E+00 1.576000E-04 2.701000E-06 750 9 1.018000E+01 1.930000E-04 8.266000E-06 750 10 1.145000E+01 2.319000E-04 1.352000E-05 750 11 1.272000E+01 2.741000E-04 1.760000E-05 750 12 1.399000E+01 3.195000E-04 2.004000E-05 750 13 1.527000E+01 3.676000E-04 2.062000E-05 750 14 1.654000E+01 4.179000E-04 1.928000E-05 750 15 1.781000E+01 4.697000E-04 1.618000E-05 750 16 1.908000E+01 5.224000E-04 1.169000E-05 750 17 2.035000E+01 5.752000E-04 6.571000E-06 750 18 2.163000E+01 6.270000E-04 4.156000E-06 750 19 2.290000E+01 6.771000E-04 8.443000E-06 750 20 2.417000E+01 7.247000E-04 1.376000E-05 750 21 2.544000E+01 7.689000E-04 1.826000E-05 750 22 2.672000E+01 8.091000E-04 2.134000E-05 750 23 2.799000E+01 8.447000E-04 2.270000E-05 750 24 2.926000E+01 8.754000E-04 2.221000E-05 750 25 3.053000E+01 9.010000E-04 1.994000E-05 750 26 3.180000E+01 9.214000E-04 1.618000E-05 750 27 3.308000E+01 9.366000E-04 1.157000E-05 750 28 3.435000E+01 9.469000E-04 7.676000E-06 750 29 3.562000E+01 9.526000E-04 8.099000E-06 750 30 3.689000E+01 9.542000E-04 1.246000E-05 750 31 3.816000E+01 9.519000E-04 1.736000E-05 750 32 3.944000E+01 9.464000E-04 2.143000E-05 750 33 4.071000E+01 9.380000E-04 2.405000E-05 750 34 4.198000E+01 9.270000E-04 2.495000E-05 750 35 4.325000E+01 9.137000E-04 2.404000E-05 750 36 4.453000E+01 8.985000E-04 2.147000E-05 750 37 4.580000E+01 8.814000E-04 1.762000E-05 750 38 4.707000E+01 8.624000E-04 1.327000E-05 750 39 4.834000E+01 8.416000E-04 1.013000E-05 750 40 4.961000E+01 8.190000E-04 1.065000E-05 750 41 5.089000E+01 7.944000E-04 1.431000E-05 750 42 5.216000E+01 7.679000E-04 1.860000E-05 750 43 5.343000E+01 7.394000E-04 2.214000E-05 750 44 5.470000E+01 7.090000E-04 2.431000E-05 750 45 5.597000E+01 6.768000E-04 2.482000E-05 750 46 5.725000E+01 6.430000E-04 2.367000E-05 750 47 5.852000E+01 6.079000E-04 2.111000E-05 750 48 5.979000E+01 5.720000E-04 1.773000E-05 750 49 6.106000E+01 5.356000E-04 1.467000E-05 750 50 6.234000E+01 4.992000E-04 1.364000E-05 750 51 6.361000E+01 4.633000E-04 1.557000E-05 750 52 6.488000E+01 4.285000E-04 1.923000E-05 750 53 6.615000E+01 3.951000E-04 2.303000E-05 750 54 6.742000E+01 3.636000E-04 2.597000E-05 750 55 6.870000E+01 3.342000E-04 2.752000E-05 750 56 6.997000E+01 3.071000E-04 2.747000E-05 750 57 7.124000E+01 2.824000E-04 2.593000E-05 750 58 7.251000E+01 2.600000E-04 2.329000E-05 750 59 7.378000E+01 2.397000E-04 2.038000E-05 750 60 7.506000E+01 2.213000E-04 1.848000E-05 750 61 7.633000E+01 2.045000E-04 1.883000E-05 750 62 7.760000E+01 1.888000E-04 2.143000E-05 750 63 7.887000E+01 1.741000E-04 2.507000E-05 750 64 8.015000E+01 1.599000E-04 2.851000E-05 750 65 8.142000E+01 1.461000E-04 3.090000E-05 750 66 8.269000E+01 1.324000E-04 3.177000E-05 750 67 8.396000E+01 1.188000E-04 3.098000E-05 750 68 8.523000E+01 1.054000E-04 2.870000E-05 750 69 8.651000E+01 9.237000E-05 2.546000E-05 750 70 8.778000E+01 7.990000E-05 2.229000E-05 750 71 8.905000E+01 6.834000E-05 2.066000E-05 750 72 9.032000E+01 5.802000E-05 2.166000E-05 750 73 9.159000E+01 4.927000E-05 2.489000E-05 750 74 9.287000E+01 4.240000E-05 2.888000E-05 750 75 9.414000E+01 3.761000E-05 3.235000E-05 750 76 9.541000E+01 3.500000E-05 3.443000E-05 750 77 9.668000E+01 3.454000E-05 3.469000E-05 750 78 9.796000E+01 3.603000E-05 3.302000E-05 750 79 9.923000E+01 3.915000E-05 2.973000E-05 750 80 1.005000E+02 4.346000E-05 2.564000E-05 750 81 1.018000E+02 4.839000E-05 2.235000E-05 750 82 1.030000E+02 5.333000E-05 2.203000E-05 750 83 1.043000E+02 5.768000E-05 2.544000E-05 750 84 1.056000E+02 6.085000E-05 3.099000E-05 750 85 1.069000E+02 6.240000E-05 3.668000E-05 750 86 1.081000E+02 6.199000E-05 4.112000E-05 750 87 1.094000E+02 5.952000E-05 4.345000E-05 750 88 1.107000E+02 5.506000E-05 4.329000E-05 750 89 1.119000E+02 4.894000E-05 4.077000E-05 750 90 1.132000E+02 4.165000E-05 3.678000E-05 750 91 1.145000E+02 3.384000E-05 3.330000E-05 750 92 1.158000E+02 2.625000E-05 3.315000E-05 750 93 1.170000E+02 1.957000E-05 3.765000E-05 750 94 1.183000E+02 1.434000E-05 4.480000E-05 750 95 1.196000E+02 1.082000E-05 5.110000E-05 750 96 1.209000E+02 8.810000E-06 5.311000E-05 750 97 1.221000E+02 7.519000E-06 4.752000E-05 750 98 1.234000E+02 5.397000E-06 3.097000E-05 750 99 1.247000E+02 0.000000E+00 0.000000E+00 # loop_ _sas_p_of_R_extrapolated_intensity.id _sas_p_of_R_extrapolated_intensity.ordinal _sas_p_of_R_extrapolated_intensity.momentum_transfer _sas_p_of_R_extrapolated_intensity.intensity_reg 750 1 0.000000E+00 5.786870E-01 750 2 3.887000E-04 5.786520E-01 750 3 7.774000E-04 5.785490E-01 750 4 1.166100E-03 5.783760E-01 750 5 1.554800E-03 5.781350E-01 750 6 1.943500E-03 5.778250E-01 750 7 2.332200E-03 5.774470E-01 750 8 2.720900E-03 5.770000E-01 750 9 3.109600E-03 5.764850E-01 750 10 3.498300E-03 5.759020E-01 750 11 3.887000E-03 5.752510E-01 750 12 4.297000E-03 5.744910E-01 750 13 4.706000E-03 5.736580E-01 750 14 5.115000E-03 5.727520E-01 750 15 5.524000E-03 5.717710E-01 750 16 5.934000E-03 5.707150E-01 750 17 6.343000E-03 5.695880E-01 750 18 6.752000E-03 5.683890E-01 750 19 7.161000E-03 5.671180E-01 750 20 7.570000E-03 5.657760E-01 750 21 7.979000E-03 5.643640E-01 750 22 8.389000E-03 5.628770E-01 750 23 8.798000E-03 5.613250E-01 750 24 9.207000E-03 5.597040E-01 750 25 9.616000E-03 5.580150E-01 750 26 1.003000E-02 5.562360E-01 750 27 1.043000E-02 5.544530E-01 750 28 1.084000E-02 5.525610E-01 750 29 1.125000E-02 5.506020E-01 750 30 1.166000E-02 5.485800E-01 750 31 1.207000E-02 5.464940E-01 750 32 1.248000E-02 5.443450E-01 750 33 1.263000E-02 5.435430E-01 750 34 1.289000E-02 5.421340E-01 750 35 1.330000E-02 5.398620E-01 750 36 1.371000E-02 5.375310E-01 750 37 1.396000E-02 5.360800E-01 750 38 1.412000E-02 5.351400E-01 750 39 1.453000E-02 5.326910E-01 750 40 1.494000E-02 5.301860E-01 750 41 1.529000E-02 5.280020E-01 750 42 1.534000E-02 5.276870E-01 750 43 1.575000E-02 5.250720E-01 750 44 1.616000E-02 5.224030E-01 750 45 1.657000E-02 5.196810E-01 750 46 1.662000E-02 5.193460E-01 750 47 1.698000E-02 5.169080E-01 750 48 1.739000E-02 5.140840E-01 750 49 1.780000E-02 5.112100E-01 750 50 1.795000E-02 5.101470E-01 750 51 1.821000E-02 5.082880E-01 750 52 1.862000E-02 5.053190E-01 750 53 1.903000E-02 5.023040E-01 750 54 1.928000E-02 5.004440E-01 750 55 1.944000E-02 4.992440E-01 750 56 1.984000E-02 4.962170E-01 750 57 2.025000E-02 4.930720E-01 750 58 2.061000E-02 4.902760E-01 750 59 2.066000E-02 4.898860E-01 750 60 2.107000E-02 4.866590E-01 750 61 2.148000E-02 4.833940E-01 750 62 2.189000E-02 4.800910E-01 750 63 2.194000E-02 4.796860E-01 750 64 2.230000E-02 4.767520E-01 750 65 2.271000E-02 4.733770E-01 750 66 2.312000E-02 4.699680E-01 750 67 2.327000E-02 4.687130E-01 750 68 2.353000E-02 4.665270E-01 750 69 2.393000E-02 4.631390E-01 750 70 2.434000E-02 4.596370E-01 750 71 2.460000E-02 4.574010E-01 750 72 2.475000E-02 4.561050E-01 750 73 2.516000E-02 4.525460E-01 750 74 2.557000E-02 4.489600E-01 750 75 2.593000E-02 4.457910E-01 750 76 2.598000E-02 4.453490E-01 750 77 2.639000E-02 4.417130E-01 750 78 2.680000E-02 4.380550E-01 750 79 2.721000E-02 4.343750E-01 750 80 2.726000E-02 4.339250E-01 750 81 2.761000E-02 4.307650E-01 750 82 2.802000E-02 4.270460E-01 750 83 2.843000E-02 4.233080E-01 750 84 2.859000E-02 4.218450E-01 750 85 2.884000E-02 4.195540E-01 750 86 2.925000E-02 4.157840E-01 750 87 2.966000E-02 4.119990E-01 750 88 2.991000E-02 4.096850E-01 750 89 3.124000E-02 3.973000E-01 750 90 3.257000E-02 3.848210E-01 750 91 3.390000E-02 3.722860E-01 750 92 3.523000E-02 3.597310E-01 750 93 3.656000E-02 3.471900E-01 750 94 3.788000E-02 3.347900E-01 750 95 3.921000E-02 3.223740E-01 750 96 4.054000E-02 3.100640E-01 750 97 4.187000E-02 2.978890E-01 750 98 4.320000E-02 2.858730E-01 750 99 4.452000E-02 2.741260E-01 750 100 4.585000E-02 2.624920E-01 750 101 4.718000E-02 2.510780E-01 750 102 4.850000E-02 2.399850E-01 750 103 4.983000E-02 2.290580E-01 750 104 5.116000E-02 2.183960E-01 750 105 5.248000E-02 2.080850E-01 750 106 5.381000E-02 1.979790E-01 750 107 5.514000E-02 1.881650E-01 750 108 5.646000E-02 1.787180E-01 750 109 5.779000E-02 1.694990E-01 750 110 5.911000E-02 1.606510E-01 750 111 6.044000E-02 1.520400E-01 750 112 6.176000E-02 1.437980E-01 750 113 6.309000E-02 1.357980E-01 750 114 6.441000E-02 1.281600E-01 750 115 6.573000E-02 1.208200E-01 750 116 6.706000E-02 1.137230E-01 750 117 6.838000E-02 1.069740E-01 750 118 6.971000E-02 1.004650E-01 750 119 7.103000E-02 9.428990E-02 750 120 7.235000E-02 8.839430E-02 750 121 7.367000E-02 8.277280E-02 750 122 7.500000E-02 7.738070E-02 750 123 7.632000E-02 7.229330E-02 750 124 7.764000E-02 6.746310E-02 750 125 7.896000E-02 6.288430E-02 750 126 8.028000E-02 5.855040E-02 750 127 8.161000E-02 5.442500E-02 750 128 8.227000E-02 5.246570E-02 750 129 8.293000E-02 5.056350E-02 750 130 8.425000E-02 4.692740E-02 750 131 8.557000E-02 4.350990E-02 750 132 8.689000E-02 4.030390E-02 750 133 8.755000E-02 3.877810E-02 750 134 8.821000E-02 3.730250E-02 750 135 8.952000E-02 3.451890E-02 750 136 9.084000E-02 3.190340E-02 750 137 9.216000E-02 2.947060E-02 750 138 9.282000E-02 2.832030E-02 750 139 9.348000E-02 2.721290E-02 750 140 9.480000E-02 2.512270E-02 750 141 9.612000E-02 2.319220E-02 750 142 9.809000E-02 2.059140E-02 750 143 1.034000E-01 1.506250E-02 750 144 1.086000E-01 1.135450E-02 750 145 1.139000E-01 8.833930E-03 750 146 1.191000E-01 7.181800E-03 750 147 1.244000E-01 5.993350E-03 750 148 1.296000E-01 5.079730E-03 750 149 1.348000E-01 4.284030E-03 750 150 1.400000E-01 3.559240E-03 750 151 1.452000E-01 2.915640E-03 750 152 1.504000E-01 2.388950E-03 750 153 1.556000E-01 2.011200E-03 750 154 1.608000E-01 1.791160E-03 750 155 1.660000E-01 1.707150E-03 750 156 1.712000E-01 1.712430E-03 750 157 1.763000E-01 1.748620E-03 750 158 1.815000E-01 1.766000E-03 750 159 1.866000E-01 1.733010E-03 750 160 1.917000E-01 1.645190E-03 750 161 1.968000E-01 1.521200E-03 750 162 2.019000E-01 1.395420E-03 750 163 2.070000E-01 1.306000E-03 750 164 2.121000E-01 1.282890E-03 750 165 2.172000E-01 1.338930E-03 750 166 2.223000E-01 1.466630E-03 #