{
"code": "SASDXG2",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Insight into the structure and interactions of the M. tuberculosis\n Mce-associated membrane proteins Mam1A-1D",
"publication": {
"title": "Insight into the structure and interactions of the M. tuberculosis\n Mce-associated membrane proteins Mam1A-1D",
"author_list": "Hynönen M, Perumal P, Hynönen N, Doutch J, Ma K, Venkatesan R",
"journal": null,
"doi": "10.1101/2025.03.26.645568",
"pmid": null,
"published_date": "2025 Mar 26"
},
"status": "released",
"submitted_date": "2025-03-26",
"released_date": "2025-04-11"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDXG2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXG2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXG2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXG2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDXG2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXG2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXG2.sascif",
"experiment": {
"instrument": {
"detector": null,
"name": "ISIS Neutron and Muon Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "SANS2D",
"beam_geometry": null,
"type_of_source": "neutron source",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Probable conserved Mce associated membrane protein",
"short_name": "Mam1A delta 106",
"sequence": "MKHHHHHHPMSDYDIPTTENLYFQGAMAPDAGAMSASMQKIIECGTGDFGAQASLYTSMLVEAYQAASVHVQVTDMRAAVERNNNDGSVDVLVALRVKVSNTDSDAHEVGYRLRVRMALDEGRYKIAKLDQVTK",
"organism": "Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)",
"uniprot_code": "O07419",
"uniprot_range_first": 107,
"uniprot_range_last": 213,
"oligomerization": "tetramer",
"molecular_type": "protein",
"uniprot_sequence": "MKAADSAESDAGADQTGPQVKAADSAESDAGELGEDACPEQALVERRPSRLRRGWLVGIA\nATLLALAGGLGAAGYFALRSHQESQSIAREDLAAIEAAKDCVAATQAPDAGAMSASMQKI\nIECGTGDFGAQASLYTSMLVEAYQAASVHVQVTDMRAAVERNNNDGSVDVLVALRVKVSN\nTDSDAHEVGYRLRVRMALDEGRYKIAKLDQVTK",
"mw": 14.807,
"total_mw": 59.228,
"number_molecules": 4,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Mam1A/Rv0175 delta 106 is N-terminally truncated construct which lacks the alpha1-helix. Protein, despite the removal of TM-helix, is not soluble and required C12E9 detergent to be solubilized. Tetrameric form was calculated with SEC-MALS."
}
],
"buffer": {
"name": "50 mM Tris, 500 mM NaCl, D-C12E9",
"concentration_unit": null,
"comment": "50mM Tris at pH8.5 with 500mM NaCl, supplemented with 0.003% Deuterated C12E9",
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.5,
"deuteration": null
},
"purity_method": null,
"name": "Probable conserved Mce associated membrane protein (Mam1Adelta106) from M.tuberculosis (SANS)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "University of Helsinki",
"webpage": null
}
],
"contributor_name": "Mikko",
"contributor_surname": "Hynönen",
"orcid": "https://orcid.org/0000-0003-2431-8892"
},
{
"affiliation": [
{
"short_name": null,
"address": "Finland",
"full_name": "University of Oulu",
"webpage": "https://www.oulu.fi"
}
],
"contributor_name": "Rajaram",
"contributor_surname": "Venkatesan",
"orcid": "https://orcid.org/0000-0002-7257-1211"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2024-04-25",
"storage_temperature": 4.0,
"cell_temperature": 6.0,
"exposure_time": null,
"number_of_frames": null,
"wavelength": null,
"sample_detector_distance": null,
"concentration_min": null,
"concentration_max": null,
"sample_volume": 35.0,
"flow_rate": 0.07,
"s_min": 0.062,
"s_max": 7.827,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/1A_107_Main_Model_Tetra_img.png",
"software": "AlphaFold",
"pdb_link": [],
"model_title": "1A_107_Main_Model_Tetra_SASDXG2",
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/1A_107_Main_Model_Tetra.pdb",
"model_mw": 59.49,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 1328
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXG2_fit1_fixed_fit_img.png",
"software": "CRYSON",
"chi_square_value": 2.58,
"p_value": 0.0272,
"fit_residual_plot": "SASDXG2_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXG2_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/SASDXG2_1A_107_Main_Model_Cryson_3Bcycig.log",
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "SANS data were collected on the Zoom time-of-flight SANS instrument (ISIS Neutron and Muon Source, Harwell, UK) using wavelength range 1.75-16.5Å. The source to sample and sample to detector distance was 4 m and the beam size was 12 mm. Mam1Adelta106 was solubilized with C12E9 in the lysis buffer where the deuteration of the C12E9 was 0.2 % v/v. Excess C12E9 was washed away throughout the purification, and replaced with D-C12E9 in the STFC SANS facilities using SEC Superdex200 column. From the highest point of the peak, 3 fractions were selected. Each of these fractions was loaded to Starna Scientific quartz round cuvette (match code 6,path length 1, type 32/Q/1), and SANS data were collected from each fraction with an exposure time of 1 h in 5 cycles (5 h total exposure time for each fraction). The neutron momentum transfer (q) standard deviation and truncated scattering data are provided as an additional file.",
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 33.1,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 20.0,
"porod_mw_error": null,
"pddf_i0": 0.126,
"pddf_i0_error": null,
"guinier_i0": 0.124085,
"guinier_i0_error": null,
"pddf_rg": 2.58,
"pddf_rg_error": null,
"guinier_rg": 2.553,
"guinier_rg_error": 0.683,
"pddf_dmax": 8.5,
"pddf_dmax_error": null,
"porod_volume": 70.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 17,
"guinier_point_last": 28,
"pddf_point_first": 18,
"pddf_point_last": 44,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDXG2_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-05-05T11:41:40.417306+02:00",
"bragg_peak": []
}