data_SASDCG9_MAIN # _sas_result.id 751 _sas_result.SASBDB_code SASDCG9 _sas_result.experimental_MW 142.000 _sas_result.experimental_MW_error . _sas_result.MW_standard . _sas_result.MW_standard_error . _sas_result.MW_Porod . _sas_result.MW_Porod_error . _sas_result.I0_from_PR 0.5146000000 _sas_result.I0_from_PR_error 0.0050000000 _sas_result.I0_from_Guinier 0.5300000000 _sas_result.I0_from_Guinier_error 0.0037000000 _sas_result.Rg_from_PR 3.207 _sas_result.Rg_from_PR_error 0.040 _sas_result.Rg_from_Guinier 3.317 _sas_result.Rg_from_Guinier_error 0.041 _sas_result.D_max 10.00 _sas_result.Porod_volume . _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min 1 _sas_result.Guinier_point_max 84 _sas_result.type_of_curve single_conc _sas_result.standard . _sas_result.Dmax_error . _sas_result.comments "Additional SANS measurement parameters. Three detector positions (in m) and count times (s) were employed: 1 m (two frames of 300 + 900 = 1200 s total count time); 4 m (one frames of 1800 s total count time); 13 m (two frames of 300 + 1200 = 1500 s total count time)." # _sas_scan.title "Nanolipoprotein Particle (NLP) with Telodendrimer - 100% D2O SANS" _sas_scan.detc_id 43 _sas_scan.id 751 _sas_scan.measurement_date 2015-11-25 _sas_scan.storage_temperature 4.0 _sas_scan.cell_temperature 20.0 _sas_scan.exposure_time 1800.000 _sas_scan.number_of_frames 1 _sas_scan.unit 1/A _sas_scan.qmin 0.0039 _sas_scan.qmax 0.5936 _sas_scan.sample_id 711 _sas_scan.result_id 751 _sas_scan.beam_id 64 # _sas_beam.id 64 _sas_beam.instrument_name "NIST Center for Neutron Research NG7" _sas_beam.instrument_city "Gaithersburg, MD" _sas_beam.instrument_country USA _sas_beam.shape . _sas_beam.type_of_source "neutron source" _sas_beam.radiation_wavelength 0.600000 _sas_beam.dist_spec_to_detc 4.00000 # _sas_detc.id 43 _sas_detc.name "Ordela 2660N" _sas_detc.type "640x640 mm 3He posn sensitive prop counter" _sas_detc.pixsize_x 5.080 # _sas_sample.id 711 _sas_sample.name "Nanolipoprotein Particle (NLP) with Telodendrimer - 100% D2O SANS" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration 0.83 _sas_sample.concentration_method . loop_ _sas_sample.entity_id 862 866 # _sas_buffer.id 428 _sas_buffer.name "PBS in D2O" _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.400 _sas_buffer.comment "8 g/L NaCl, 0.2 g/L KH2PO4, 1.15 g/L Na2HPO4, 0.2 g/L KCl, in D2O with no additional pH adjustment" _sas_buffer.composition . _sas_buffer.sample_id 711 # loop_ _entity.id _entity.type _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules 862 other 1,2-dimyristoyl-sn-glycero-3-phosphocholine 0.678 . 866 protein "Apolipoprotein A-I" 26.068 2 # loop_ _entity_name_com.entity_id _entity_name_com.name 862 DMPC 866 ApoA-I # loop_ _entity_poly.entity_id _entity_poly.pdbx_seq_one_letter_code 862 N/A 866 MSGSHHHHHHSSGIEGRGRLIKHMLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTKAQSVIDKASETLTAQGSG # loop_ _entity_src_gen.entity_id _entity_src_gen.gene_src_common_name 862 . 866 "Mus musculus" # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code 1 862 UniProt . 2 866 UniProt Q00623 _struct_ref.details http://www.uniprot.org/uniprot/Q00623 # _citation.id 305 _citation.title "Small-angle X-ray and neutron scattering demonstrates that cell-free expression produces properly formed disc-shaped nanolipoprotein particles." _citation.year "2017 Dec 20" _citation.pdbx_database_id_DOI 10.1002/pro.3365 _citation.pdbx_database_id_PubMed 29266475 # loop_ _citation_author.citation_id _citation_author.ordinal _citation_author.name 305 1 "Cleveland TE 4th" 305 2 "He W" 305 3 "Evans AC" 305 4 "Fischer NO" 305 5 "Lau EY" 305 6 "Coleman MA" # _pdbx_contact_author.id 197 _pdbx_contact_author.name_first Thomas _pdbx_contact_author.name_last Cleveland _pdbx_contact_author.role . _pdbx_contact_author.address_1 . _pdbx_contact_author.address_2 "National Institute of Standards and Technology, Gaithersburg, MD, USA" _pdbx_contact_author.address_3 . # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 3.887000E-03 5.721410E-01 2.146000E-01 751 2 4.297000E-03 4.276410E-01 1.585000E-01 751 3 4.706000E-03 4.540410E-01 1.398000E-01 751 4 5.115000E-03 6.248410E-01 1.248000E-01 751 5 5.524000E-03 6.748410E-01 1.068000E-01 751 6 5.934000E-03 5.544410E-01 9.061000E-02 751 7 6.343000E-03 4.255410E-01 8.445000E-02 751 8 6.752000E-03 4.543410E-01 7.602000E-02 751 9 7.161000E-03 4.428410E-01 7.714000E-02 751 10 7.570000E-03 5.059410E-01 6.466000E-02 751 11 7.979000E-03 4.842410E-01 6.066000E-02 751 12 8.389000E-03 4.268410E-01 5.736000E-02 751 13 8.798000E-03 5.948410E-01 5.126000E-02 751 14 9.207000E-03 3.948410E-01 6.179000E-02 751 15 9.616000E-03 5.994410E-01 4.784000E-02 751 16 1.003000E-02 4.983410E-01 4.672000E-02 751 17 1.043000E-02 5.142410E-01 4.522000E-02 751 18 1.084000E-02 4.752410E-01 4.671000E-02 751 19 1.125000E-02 5.008410E-01 3.810000E-02 751 20 1.166000E-02 4.531410E-01 3.746000E-02 751 21 1.207000E-02 4.417410E-01 4.095000E-02 751 22 1.248000E-02 4.708410E-01 4.083000E-02 751 23 1.263000E-02 4.973410E-01 7.962000E-03 751 24 1.289000E-02 5.255410E-01 3.743000E-02 751 25 1.330000E-02 5.205410E-01 3.583000E-02 751 26 1.371000E-02 4.723410E-01 3.375000E-02 751 27 1.396000E-02 4.932410E-01 9.189000E-03 751 28 1.412000E-02 4.576410E-01 4.132000E-02 751 29 1.453000E-02 4.476410E-01 3.298000E-02 751 30 1.494000E-02 5.131410E-01 3.839000E-02 751 31 1.529000E-02 4.801410E-01 9.729000E-03 751 32 1.534000E-02 5.075410E-01 3.000000E-02 751 33 1.575000E-02 4.337410E-01 3.187000E-02 751 34 1.616000E-02 4.606410E-01 3.619000E-02 751 35 1.657000E-02 4.638410E-01 3.151000E-02 751 36 1.662000E-02 4.821410E-01 9.874000E-03 751 37 1.698000E-02 4.693410E-01 3.326000E-02 751 38 1.739000E-02 5.032410E-01 2.891000E-02 751 39 1.780000E-02 4.654410E-01 3.010000E-02 751 40 1.795000E-02 4.708410E-01 8.276000E-03 751 41 1.821000E-02 5.247410E-01 2.836000E-02 751 42 1.862000E-02 4.392410E-01 2.867000E-02 751 43 1.903000E-02 4.307410E-01 2.984000E-02 751 44 1.928000E-02 4.558410E-01 8.425000E-03 751 45 1.944000E-02 4.428410E-01 2.917000E-02 751 46 1.984000E-02 4.359410E-01 2.989000E-02 751 47 2.025000E-02 4.454410E-01 2.675000E-02 751 48 2.061000E-02 4.458410E-01 8.022000E-03 751 49 2.066000E-02 4.706410E-01 2.885000E-02 751 50 2.107000E-02 4.057410E-01 2.910000E-02 751 51 2.148000E-02 4.329410E-01 2.696000E-02 751 52 2.189000E-02 4.166410E-01 2.408000E-02 751 53 2.194000E-02 4.431410E-01 6.795000E-03 751 54 2.230000E-02 4.349410E-01 2.686000E-02 751 55 2.271000E-02 4.511410E-01 2.690000E-02 751 56 2.312000E-02 4.429410E-01 2.630000E-02 751 57 2.327000E-02 4.392410E-01 6.480000E-03 751 58 2.353000E-02 4.598410E-01 2.594000E-02 751 59 2.393000E-02 3.899410E-01 2.551000E-02 751 60 2.434000E-02 3.970410E-01 2.600000E-02 751 61 2.460000E-02 4.157410E-01 6.547000E-03 751 62 2.475000E-02 4.109410E-01 2.472000E-02 751 63 2.516000E-02 4.241410E-01 2.772000E-02 751 64 2.557000E-02 4.083410E-01 2.745000E-02 751 65 2.593000E-02 4.148410E-01 5.645000E-03 751 66 2.598000E-02 4.240410E-01 3.068000E-02 751 67 2.639000E-02 3.998410E-01 2.949000E-02 751 68 2.680000E-02 4.136410E-01 2.975000E-02 751 69 2.721000E-02 4.089410E-01 3.288000E-02 751 70 2.726000E-02 3.978410E-01 6.561000E-03 751 71 2.761000E-02 4.142410E-01 3.542000E-02 751 72 2.802000E-02 4.287410E-01 3.098000E-02 751 73 2.843000E-02 4.411410E-01 3.439000E-02 751 74 2.859000E-02 3.866410E-01 7.100000E-03 751 75 2.884000E-02 3.183410E-01 3.560000E-02 751 76 2.925000E-02 3.617410E-01 3.852000E-02 751 77 2.966000E-02 3.390410E-01 3.708000E-02 751 78 2.991000E-02 3.871410E-01 6.717000E-03 751 79 3.124000E-02 3.684410E-01 5.536000E-03 751 80 3.257000E-02 3.553410E-01 5.549000E-03 751 81 3.390000E-02 3.442410E-01 5.962000E-03 751 82 3.523000E-02 3.221410E-01 5.543000E-03 751 83 3.656000E-02 3.196410E-01 5.414000E-03 751 84 3.788000E-02 3.194410E-01 4.695000E-03 751 85 3.921000E-02 2.963410E-01 5.124000E-03 751 86 4.054000E-02 2.882410E-01 4.603000E-03 751 87 4.187000E-02 2.756410E-01 4.695000E-03 751 88 4.320000E-02 2.723410E-01 4.379000E-03 751 89 4.452000E-02 2.590410E-01 4.510000E-03 751 90 4.585000E-02 2.523410E-01 4.189000E-03 751 91 4.718000E-02 2.355410E-01 4.029000E-03 751 92 4.850000E-02 2.212410E-01 4.239000E-03 751 93 4.983000E-02 2.154410E-01 3.995000E-03 751 94 5.116000E-02 2.088410E-01 4.211000E-03 751 95 5.248000E-02 1.998410E-01 4.024000E-03 751 96 5.381000E-02 1.821410E-01 3.602000E-03 751 97 5.514000E-02 1.775410E-01 3.411000E-03 751 98 5.646000E-02 1.761410E-01 3.511000E-03 751 99 5.779000E-02 1.612410E-01 3.383000E-03 751 100 5.911000E-02 1.479410E-01 3.362000E-03 751 101 6.044000E-02 1.432410E-01 3.282000E-03 751 102 6.176000E-02 1.284410E-01 3.226000E-03 751 103 6.309000E-02 1.293410E-01 3.320000E-03 751 104 6.441000E-02 1.154410E-01 3.129000E-03 751 105 6.573000E-02 1.126410E-01 3.099000E-03 751 106 6.706000E-02 1.070410E-01 3.067000E-03 751 107 6.838000E-02 9.944070E-02 2.828000E-03 751 108 6.971000E-02 9.424070E-02 2.824000E-03 751 109 7.103000E-02 8.594070E-02 2.869000E-03 751 110 7.235000E-02 8.264070E-02 2.994000E-03 751 111 7.367000E-02 7.934070E-02 2.811000E-03 751 112 7.500000E-02 6.854070E-02 2.646000E-03 751 113 7.632000E-02 6.724070E-02 2.622000E-03 751 114 7.764000E-02 6.054070E-02 2.656000E-03 751 115 7.896000E-02 5.584070E-02 2.655000E-03 751 116 8.028000E-02 5.634070E-02 2.580000E-03 751 117 8.161000E-02 4.574070E-02 2.843000E-03 751 118 8.227000E-02 4.644070E-02 1.297000E-03 751 119 8.293000E-02 4.414070E-02 2.670000E-03 751 120 8.425000E-02 4.494070E-02 2.959000E-03 751 121 8.557000E-02 3.978070E-02 2.869000E-03 751 122 8.689000E-02 4.224070E-02 3.291000E-03 751 123 8.755000E-02 3.420070E-02 1.085000E-03 751 124 8.821000E-02 3.281070E-02 3.491000E-03 751 125 8.952000E-02 2.801070E-02 3.539000E-03 751 126 9.084000E-02 3.156070E-02 3.760000E-03 751 127 9.216000E-02 2.064070E-02 3.373000E-03 751 128 9.282000E-02 2.493070E-02 1.010000E-03 751 129 9.348000E-02 2.567070E-02 4.108000E-03 751 130 9.480000E-02 2.337070E-02 4.057000E-03 751 131 9.612000E-02 2.768070E-02 3.853000E-03 751 132 9.809000E-02 1.803070E-02 1.102000E-03 751 133 1.034000E-01 1.481070E-02 9.494000E-04 751 134 1.086000E-01 1.060070E-02 8.237000E-04 751 135 1.139000E-01 7.850700E-03 7.989000E-04 751 136 1.191000E-01 7.650700E-03 9.131000E-04 751 137 1.244000E-01 5.810700E-03 7.952000E-04 751 138 1.296000E-01 3.320700E-03 7.847000E-04 751 139 1.348000E-01 5.180700E-03 8.558000E-04 751 140 1.400000E-01 3.760700E-03 8.313000E-04 751 141 1.452000E-01 2.710700E-03 8.017000E-04 751 142 1.504000E-01 1.110700E-03 8.159000E-04 751 143 1.556000E-01 2.900700E-03 7.815000E-04 751 144 1.608000E-01 1.560700E-03 7.206000E-04 751 145 1.660000E-01 3.020700E-03 7.921000E-04 751 146 1.712000E-01 2.910700E-03 7.777000E-04 751 147 1.763000E-01 2.600700E-03 7.111000E-04 751 148 1.815000E-01 1.807000E-04 8.052000E-04 751 149 1.866000E-01 2.370700E-03 7.495000E-04 751 150 1.917000E-01 1.900700E-03 6.965000E-04 751 151 1.968000E-01 9.107000E-04 7.100000E-04 751 152 2.019000E-01 1.260700E-03 7.106000E-04 751 153 2.070000E-01 1.810700E-03 6.601000E-04 751 154 2.121000E-01 1.760700E-03 6.934000E-04 751 155 2.172000E-01 9.007000E-04 6.403000E-04 751 156 2.223000E-01 7.307000E-04 6.886000E-04 751 157 2.273000E-01 -4.993000E-04 6.563000E-04 751 158 2.323000E-01 1.270700E-03 6.844000E-04 751 159 2.374000E-01 3.307000E-04 5.949000E-04 751 160 2.424000E-01 1.580700E-03 6.694000E-04 751 161 2.474000E-01 7.507000E-04 5.933000E-04 751 162 2.524000E-01 -1.793000E-04 5.867000E-04 751 163 2.573000E-01 3.407000E-04 6.313000E-04 751 164 2.623000E-01 1.707000E-04 6.538000E-04 751 165 2.672000E-01 1.130700E-03 6.253000E-04 751 166 2.722000E-01 1.040700E-03 6.481000E-04 751 167 2.771000E-01 4.407000E-04 5.869000E-04 751 168 2.820000E-01 1.610700E-03 5.429000E-04 751 169 2.869000E-01 -2.593000E-04 6.647000E-04 751 170 2.917000E-01 1.200700E-03 5.389000E-04 751 171 2.966000E-01 9.607000E-04 5.788000E-04 751 172 3.015000E-01 1.020700E-03 6.382000E-04 751 173 3.063000E-01 1.407000E-04 5.597000E-04 751 174 3.111000E-01 -2.793000E-04 6.377000E-04 751 175 3.159000E-01 -3.893000E-04 6.005000E-04 751 176 3.207000E-01 -8.930000E-05 6.409000E-04 751 177 3.254000E-01 -4.493000E-04 6.329000E-04 751 178 3.302000E-01 3.807000E-04 7.000000E-04 751 179 3.349000E-01 2.070700E-03 6.789000E-04 751 180 3.397000E-01 -3.593000E-04 6.327000E-04 751 181 3.444000E-01 -1.793000E-04 7.413000E-04 751 182 3.490000E-01 9.207000E-04 7.389000E-04 751 183 3.537000E-01 -3.193000E-04 6.963000E-04 751 184 3.584000E-01 1.007000E-04 7.518000E-04 751 185 3.630000E-01 1.780700E-03 7.022000E-04 751 186 3.676000E-01 -3.693000E-04 7.487000E-04 751 187 3.722000E-01 7.070000E-05 6.880000E-04 751 188 3.768000E-01 1.880700E-03 7.274000E-04 751 189 3.814000E-01 7.907000E-04 7.287000E-04 751 190 3.859000E-01 -2.793000E-04 6.650000E-04 751 191 3.905000E-01 9.070000E-05 7.563000E-04 751 192 3.950000E-01 8.107000E-04 7.129000E-04 751 193 3.995000E-01 -9.893000E-04 7.341000E-04 751 194 4.040000E-01 -2.930000E-05 7.570000E-04 751 195 4.084000E-01 3.707000E-04 6.601000E-04 751 196 4.129000E-01 -1.439300E-03 7.455000E-04 751 197 4.173000E-01 2.507000E-04 7.299000E-04 751 198 4.217000E-01 8.707000E-04 8.742000E-04 751 199 4.261000E-01 -1.199300E-03 7.228000E-04 751 200 4.305000E-01 -1.393000E-04 7.307000E-04 751 201 4.348000E-01 -1.889300E-03 7.344000E-04 751 202 4.392000E-01 -1.493000E-04 7.074000E-04 751 203 4.435000E-01 3.070000E-05 7.792000E-04 751 204 4.478000E-01 2.207000E-04 7.501000E-04 751 205 4.521000E-01 -9.193000E-04 8.300000E-04 751 206 4.563000E-01 5.070000E-05 8.024000E-04 751 207 4.606000E-01 -9.793000E-04 7.887000E-04 751 208 4.648000E-01 -1.169300E-03 7.335000E-04 751 209 4.690000E-01 -8.993000E-04 8.014000E-04 751 210 4.732000E-01 -1.919300E-03 8.810000E-04 751 211 4.774000E-01 -6.993000E-04 7.300000E-04 751 212 4.815000E-01 -1.009300E-03 7.287000E-04 751 213 4.856000E-01 -1.059300E-03 8.295000E-04 751 214 4.897000E-01 -1.819300E-03 7.795000E-04 751 215 4.938000E-01 -1.019300E-03 8.309000E-04 751 216 4.979000E-01 -4.993000E-04 8.578000E-04 751 217 5.020000E-01 -7.493000E-04 8.650000E-04 751 218 5.060000E-01 -8.493000E-04 7.822000E-04 751 219 5.100000E-01 -6.693000E-04 8.119000E-04 751 220 5.140000E-01 -1.299300E-03 7.905000E-04 751 221 5.180000E-01 -1.093000E-04 8.810000E-04 751 222 5.220000E-01 -2.193000E-04 8.959000E-04 751 223 5.259000E-01 1.807000E-04 7.996000E-04 751 224 5.298000E-01 -1.599300E-03 7.743000E-04 751 225 5.337000E-01 -6.393000E-04 9.368000E-04 751 226 5.376000E-01 -1.219300E-03 9.263000E-04 751 227 5.415000E-01 -2.393000E-04 9.781000E-04 751 228 5.453000E-01 -2.119300E-03 1.081000E-03 751 229 5.492000E-01 5.507000E-04 1.152000E-03 751 230 5.530000E-01 -6.193000E-04 9.661000E-04 751 231 5.568000E-01 -2.319300E-03 1.253000E-03 751 232 5.605000E-01 -1.649300E-03 1.352000E-03 751 233 5.643000E-01 -2.319300E-03 1.303000E-03 751 234 5.680000E-01 1.710700E-03 1.532000E-03 751 235 5.717000E-01 2.280700E-03 1.640000E-03 751 236 5.754000E-01 1.507000E-04 2.112000E-03 751 237 5.791000E-01 8.207000E-04 2.754000E-03 751 238 5.828000E-01 -1.789300E-03 2.821000E-03 751 239 5.864000E-01 6.240700E-03 3.979000E-03 751 240 5.900000E-01 -4.829300E-03 3.613000E-03 751 241 5.936000E-01 5.840700E-03 3.917000E-03 751 # _sas_p_of_R_details.id 751 _sas_p_of_R_details.intensity_id 751 _sas_p_of_R_details.software_p_of_R "GNOM 5.0" _sas_p_of_R_details.number_of_points 159 _sas_p_of_R_details.qmin 0.003887 _sas_p_of_R_details.qmax 0.2374 _sas_p_of_R_details.p_of_R_point_min 1 _sas_p_of_R_details.p_of_R_point_max 159 _sas_p_of_R_details.Rmin 0.0 _sas_p_of_R_details.Rmax 100.3 # loop_ _sas_p_of_R.id _sas_p_of_R.ordinal _sas_p_of_R.r _sas_p_of_R.P _sas_p_of_R.P_error 751 1 0.000000E+00 0.000000E+00 0.000000E+00 751 2 1.056000E+00 4.061000E-06 4.746000E-06 751 3 2.113000E+00 1.212000E-05 7.695000E-06 751 4 3.169000E+00 2.410000E-05 8.967000E-06 751 5 4.225000E+00 3.985000E-05 8.755000E-06 751 6 5.282000E+00 5.916000E-05 7.315000E-06 751 7 6.338000E+00 8.180000E-05 4.975000E-06 751 8 7.394000E+00 1.075000E-04 2.287000E-06 751 9 8.451000E+00 1.359000E-04 2.305000E-06 751 10 9.507000E+00 1.667000E-04 5.265000E-06 751 11 1.056000E+01 1.995000E-04 8.199000E-06 751 12 1.162000E+01 2.339000E-04 1.062000E-05 751 13 1.268000E+01 2.696000E-04 1.231000E-05 751 14 1.373000E+01 3.063000E-04 1.312000E-05 751 15 1.479000E+01 3.436000E-04 1.300000E-05 751 16 1.584000E+01 3.811000E-04 1.199000E-05 751 17 1.690000E+01 4.186000E-04 1.019000E-05 751 18 1.796000E+01 4.559000E-04 7.811000E-06 751 19 1.901000E+01 4.926000E-04 5.303000E-06 751 20 2.007000E+01 5.285000E-04 3.849000E-06 751 21 2.113000E+01 5.635000E-04 5.030000E-06 751 22 2.218000E+01 5.974000E-04 7.559000E-06 751 23 2.324000E+01 6.301000E-04 1.010000E-05 751 24 2.430000E+01 6.614000E-04 1.216000E-05 751 25 2.535000E+01 6.913000E-04 1.351000E-05 751 26 2.641000E+01 7.196000E-04 1.405000E-05 751 27 2.746000E+01 7.462000E-04 1.373000E-05 751 28 2.852000E+01 7.710000E-04 1.262000E-05 751 29 2.958000E+01 7.940000E-04 1.088000E-05 751 30 3.063000E+01 8.150000E-04 8.834000E-06 751 31 3.169000E+01 8.339000E-04 7.070000E-06 751 32 3.275000E+01 8.506000E-04 6.550000E-06 751 33 3.380000E+01 8.650000E-04 7.727000E-06 751 34 3.486000E+01 8.769000E-04 9.836000E-06 751 35 3.591000E+01 8.863000E-04 1.204000E-05 751 36 3.697000E+01 8.930000E-04 1.385000E-05 751 37 3.803000E+01 8.971000E-04 1.501000E-05 751 38 3.908000E+01 8.983000E-04 1.540000E-05 751 39 4.014000E+01 8.966000E-04 1.499000E-05 751 40 4.120000E+01 8.921000E-04 1.386000E-05 751 41 4.225000E+01 8.847000E-04 1.219000E-05 751 42 4.331000E+01 8.746000E-04 1.036000E-05 751 43 4.437000E+01 8.618000E-04 8.971000E-06 751 44 4.542000E+01 8.465000E-04 8.735000E-06 751 45 4.648000E+01 8.288000E-04 9.862000E-06 751 46 4.753000E+01 8.090000E-04 1.178000E-05 751 47 4.859000E+01 7.872000E-04 1.382000E-05 751 48 4.965000E+01 7.638000E-04 1.552000E-05 751 49 5.070000E+01 7.391000E-04 1.661000E-05 751 50 5.176000E+01 7.132000E-04 1.697000E-05 751 51 5.282000E+01 6.866000E-04 1.661000E-05 751 52 5.387000E+01 6.595000E-04 1.565000E-05 751 53 5.493000E+01 6.321000E-04 1.437000E-05 751 54 5.598000E+01 6.047000E-04 1.322000E-05 751 55 5.704000E+01 5.775000E-04 1.273000E-05 751 56 5.810000E+01 5.507000E-04 1.329000E-05 751 57 5.915000E+01 5.244000E-04 1.479000E-05 751 58 6.021000E+01 4.987000E-04 1.677000E-05 751 59 6.127000E+01 4.737000E-04 1.872000E-05 751 60 6.232000E+01 4.493000E-04 2.027000E-05 751 61 6.338000E+01 4.256000E-04 2.116000E-05 751 62 6.444000E+01 4.026000E-04 2.127000E-05 751 63 6.549000E+01 3.801000E-04 2.061000E-05 751 64 6.655000E+01 3.581000E-04 1.931000E-05 751 65 6.760000E+01 3.366000E-04 1.765000E-05 751 66 6.866000E+01 3.155000E-04 1.608000E-05 751 67 6.972000E+01 2.948000E-04 1.514000E-05 751 68 7.077000E+01 2.743000E-04 1.522000E-05 751 69 7.183000E+01 2.542000E-04 1.631000E-05 751 70 7.289000E+01 2.344000E-04 1.795000E-05 751 71 7.394000E+01 2.149000E-04 1.961000E-05 751 72 7.500000E+01 1.959000E-04 2.086000E-05 751 73 7.605000E+01 1.773000E-04 2.145000E-05 751 74 7.711000E+01 1.594000E-04 2.133000E-05 751 75 7.817000E+01 1.422000E-04 2.061000E-05 751 76 7.922000E+01 1.258000E-04 1.964000E-05 751 77 8.028000E+01 1.104000E-04 1.895000E-05 751 78 8.134000E+01 9.603000E-05 1.910000E-05 751 79 8.239000E+01 8.277000E-05 2.042000E-05 751 80 8.345000E+01 7.070000E-05 2.270000E-05 751 81 8.451000E+01 5.985000E-05 2.540000E-05 751 82 8.556000E+01 5.021000E-05 2.796000E-05 751 83 8.662000E+01 4.176000E-05 2.989000E-05 751 84 8.767000E+01 3.445000E-05 3.092000E-05 751 85 8.873000E+01 2.820000E-05 3.094000E-05 751 86 8.979000E+01 2.291000E-05 3.009000E-05 751 87 9.084000E+01 1.847000E-05 2.876000E-05 751 88 9.190000E+01 1.476000E-05 2.755000E-05 751 89 9.296000E+01 1.168000E-05 2.708000E-05 751 90 9.401000E+01 9.113000E-06 2.761000E-05 751 91 9.507000E+01 6.964000E-06 2.866000E-05 751 92 9.612000E+01 5.153000E-06 2.921000E-05 751 93 9.718000E+01 3.610000E-06 2.793000E-05 751 94 9.824000E+01 2.275000E-06 2.349000E-05 751 95 9.929000E+01 1.093000E-06 1.458000E-05 751 96 1.003000E+02 0.000000E+00 0.000000E+00 # loop_ _sas_p_of_R_extrapolated_intensity.id _sas_p_of_R_extrapolated_intensity.ordinal _sas_p_of_R_extrapolated_intensity.momentum_transfer _sas_p_of_R_extrapolated_intensity.intensity_reg 751 1 0.000000E+00 5.146120E-01 751 2 3.887000E-04 5.145850E-01 751 3 7.774000E-04 5.145050E-01 751 4 1.166100E-03 5.143720E-01 751 5 1.554800E-03 5.141850E-01 751 6 1.943500E-03 5.139460E-01 751 7 2.332200E-03 5.136530E-01 751 8 2.720900E-03 5.133070E-01 751 9 3.109600E-03 5.129080E-01 751 10 3.498300E-03 5.124560E-01 751 11 3.887000E-03 5.119520E-01 751 12 4.297000E-03 5.113630E-01 751 13 4.706000E-03 5.107180E-01 751 14 5.115000E-03 5.100140E-01 751 15 5.524000E-03 5.092530E-01 751 16 5.934000E-03 5.084330E-01 751 17 6.343000E-03 5.075580E-01 751 18 6.752000E-03 5.066260E-01 751 19 7.161000E-03 5.056370E-01 751 20 7.570000E-03 5.045930E-01 751 21 7.979000E-03 5.034920E-01 751 22 8.389000E-03 5.023340E-01 751 23 8.798000E-03 5.011230E-01 751 24 9.207000E-03 4.998570E-01 751 25 9.616000E-03 4.985370E-01 751 26 1.003000E-02 4.971460E-01 751 27 1.043000E-02 4.957510E-01 751 28 1.084000E-02 4.942670E-01 751 29 1.125000E-02 4.927310E-01 751 30 1.166000E-02 4.911430E-01 751 31 1.207000E-02 4.895030E-01 751 32 1.248000E-02 4.878120E-01 751 33 1.263000E-02 4.871810E-01 751 34 1.289000E-02 4.860710E-01 751 35 1.330000E-02 4.842790E-01 751 36 1.371000E-02 4.824380E-01 751 37 1.396000E-02 4.812910E-01 751 38 1.412000E-02 4.805470E-01 751 39 1.453000E-02 4.786090E-01 751 40 1.494000E-02 4.766230E-01 751 41 1.529000E-02 4.748900E-01 751 42 1.534000E-02 4.746390E-01 751 43 1.575000E-02 4.725610E-01 751 44 1.616000E-02 4.704360E-01 751 45 1.657000E-02 4.682660E-01 751 46 1.662000E-02 4.679990E-01 751 47 1.698000E-02 4.660520E-01 751 48 1.739000E-02 4.637940E-01 751 49 1.780000E-02 4.614930E-01 751 50 1.795000E-02 4.606410E-01 751 51 1.821000E-02 4.591500E-01 751 52 1.862000E-02 4.567650E-01 751 53 1.903000E-02 4.543390E-01 751 54 1.928000E-02 4.528400E-01 751 55 1.944000E-02 4.518730E-01 751 56 1.984000E-02 4.494290E-01 751 57 2.025000E-02 4.468860E-01 751 58 2.061000E-02 4.446220E-01 751 59 2.066000E-02 4.443050E-01 751 60 2.107000E-02 4.416870E-01 751 61 2.148000E-02 4.390320E-01 751 62 2.189000E-02 4.363420E-01 751 63 2.194000E-02 4.360120E-01 751 64 2.230000E-02 4.336180E-01 751 65 2.271000E-02 4.308590E-01 751 66 2.312000E-02 4.280670E-01 751 67 2.327000E-02 4.270380E-01 751 68 2.353000E-02 4.252440E-01 751 69 2.393000E-02 4.224580E-01 751 70 2.434000E-02 4.195730E-01 751 71 2.460000E-02 4.177280E-01 751 72 2.475000E-02 4.166590E-01 751 73 2.516000E-02 4.137150E-01 751 74 2.557000E-02 4.107430E-01 751 75 2.593000E-02 4.081120E-01 751 76 2.598000E-02 4.077440E-01 751 77 2.639000E-02 4.047190E-01 751 78 2.680000E-02 4.016690E-01 751 79 2.721000E-02 3.985940E-01 751 80 2.726000E-02 3.982170E-01 751 81 2.761000E-02 3.955710E-01 751 82 2.802000E-02 3.924500E-01 751 83 2.843000E-02 3.893070E-01 751 84 2.859000E-02 3.880740E-01 751 85 2.884000E-02 3.861420E-01 751 86 2.925000E-02 3.829580E-01 751 87 2.966000E-02 3.797550E-01 751 88 2.991000E-02 3.777920E-01 751 89 3.124000E-02 3.672450E-01 751 90 3.257000E-02 3.565390E-01 751 91 3.390000E-02 3.457060E-01 751 92 3.523000E-02 3.347730E-01 751 93 3.656000E-02 3.237720E-01 751 94 3.788000E-02 3.128130E-01 751 95 3.921000E-02 3.017580E-01 751 96 4.054000E-02 2.907170E-01 751 97 4.187000E-02 2.797180E-01 751 98 4.320000E-02 2.687850E-01 751 99 4.452000E-02 2.580230E-01 751 100 4.585000E-02 2.472940E-01 751 101 4.718000E-02 2.367000E-01 751 102 4.850000E-02 2.263410E-01 751 103 4.983000E-02 2.160790E-01 751 104 5.116000E-02 2.060110E-01 751 105 5.248000E-02 1.962270E-01 751 106 5.381000E-02 1.865940E-01 751 107 5.514000E-02 1.772000E-01 751 108 5.646000E-02 1.681270E-01 751 109 5.779000E-02 1.592470E-01 751 110 5.911000E-02 1.507030E-01 751 111 6.044000E-02 1.423740E-01 751 112 6.176000E-02 1.343910E-01 751 113 6.309000E-02 1.266390E-01 751 114 6.441000E-02 1.192370E-01 751 115 6.573000E-02 1.121300E-01 751 116 6.706000E-02 1.052680E-01 751 117 6.838000E-02 9.875320E-02 751 118 6.971000E-02 9.248710E-02 751 119 7.103000E-02 8.656150E-02 751 120 7.235000E-02 8.092500E-02 751 121 7.367000E-02 7.557360E-02 751 122 7.500000E-02 7.046500E-02 751 123 7.632000E-02 6.567030E-02 751 124 7.764000E-02 6.114370E-02 751 125 7.896000E-02 5.687800E-02 751 126 8.028000E-02 5.286580E-02 751 127 8.161000E-02 4.907120E-02 751 128 8.227000E-02 4.727800E-02 751 129 8.293000E-02 4.554280E-02 751 130 8.425000E-02 4.224210E-02 751 131 8.557000E-02 3.916010E-02 751 132 8.689000E-02 3.628720E-02 751 133 8.755000E-02 3.492630E-02 751 134 8.821000E-02 3.361410E-02 751 135 8.952000E-02 3.114910E-02 751 136 9.084000E-02 2.884500E-02 751 137 9.216000E-02 2.671160E-02 751 138 9.282000E-02 2.570600E-02 751 139 9.348000E-02 2.473940E-02 751 140 9.480000E-02 2.291910E-02 751 141 9.612000E-02 2.124100E-02 751 142 9.809000E-02 1.898200E-02 751 143 1.034000E-01 1.414940E-02 751 144 1.086000E-01 1.081120E-02 751 145 1.139000E-01 8.413890E-03 751 146 1.191000E-01 6.737540E-03 751 147 1.244000E-01 5.489550E-03 751 148 1.296000E-01 4.569140E-03 751 149 1.348000E-01 3.859690E-03 751 150 1.400000E-01 3.309840E-03 751 151 1.452000E-01 2.890640E-03 751 152 1.504000E-01 2.583040E-03 751 153 1.556000E-01 2.370060E-03 751 154 1.608000E-01 2.232450E-03 751 155 1.660000E-01 2.148070E-03 751 156 1.712000E-01 2.093130E-03 751 157 1.763000E-01 2.045920E-03 751 158 1.815000E-01 1.985830E-03 751 159 1.866000E-01 1.902440E-03 751 160 1.917000E-01 1.788600E-03 751 161 1.968000E-01 1.644480E-03 751 162 2.019000E-01 1.475540E-03 751 163 2.070000E-01 1.291010E-03 751 164 2.121000E-01 1.101950E-03 751 165 2.172000E-01 9.195120E-04 751 166 2.223000E-01 7.533650E-04 751 167 2.273000E-01 6.132180E-04 751 168 2.323000E-01 4.995610E-04 751 169 2.374000E-01 4.120560E-04 #