{ "code": "SASDBJ6", "status": "Published", "type_of_curve": "Single concentration", "angular_unit": "1/A", "project": { "title": "The C-terminal region of the human p23 chaperone modulates its structure and function.", "publication": { "title": "The C-terminal region of the human p23 chaperone modulates its structure and function.", "author_list": "Seraphim TV, Gava LM, Mokry DZ, Cagliari TC, Barbosa LR, Ramos CH, Borges JC", "journal": "Arch Biochem Biophys", "doi": "10.1016/j.abb.2014.10.015", "pmid": "25447839", "published_date": "2015 Jan 1" }, "status": "released", "submitted_date": "2016-09-13", "released_date": "2016-10-05" }, "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBJ6.out", "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBJ6.dat", "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBJ6_modified_dat_img.png", "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBJ6_modified_kratky_img.png", "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBJ6_wDmeuwI_pofr_img.png", "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBJ6_modified_guinier_img.png", "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBJ6.sascif", "experiment": { "instrument": { "detector": { "type": "20Hz", "name": "Pilatus 300K", "resolution": null }, "name": "Brazilian Synchrotron Light Laboratory", "city": "Campinas", "country": "Brazil", "beamline_name": "SAXS1 Beamline", "beam_geometry": "", "type_of_source": "X-ray synchrotron", "point_source": null, "line_collimation": null, "sample_path_length": null, "line_collimation_slitlength": null, "line_collimation_integrationwidth": null, "xray_energy": null, "beam_profile_ah": null, "beam_profile_al": null }, "sample": { "molecule": [ { "long_name": "Prostaglandin E synthase 3 (1-142)", "short_name": "PTGES, Sba1, p23", "sequence": "GSMQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID\r\nPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNF\r\nDRFSEMMNNMGGDEDVDLPEVD", "organism": "Homo sapiens", "uniprot_code": "Q15185", "uniprot_range_first": 1, "uniprot_range_last": 142, "oligomerization": "monomer", "molecular_type": "protein", "uniprot_sequence": "MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID\nPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNF\nDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE", "mw": 16.877, "total_mw": 16.877, "number_molecules": 1, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null } ], "buffer": { "name": "25 mM Tris-HCl, 100 mM NaCl, 5 mM B-mercaptoethanol", "concentration_unit": null, "comment": null, "additive": null, "concentration": null, "pka": null, "ph": 7.5, "deuteration": null }, "purity_method": null, "name": "Truncated construct of human p23 (1-142)", "ext_coefficient": null, "contrast": null, "specific_vol": null, "dry_vol": null, "absorbption": null, "deuteration": null, "mixture": null }, "contributor": [ { "affiliation": [ { "short_name": null, "address": "São Carlos - SP - Brasil", "full_name": "Instituto de Química de São Carlos", "webpage": "" } ], "contributor_name": "Júlio", "contributor_surname": "Borges", "orcid": null } ], "concentration_method": null, "concentration_unit": null, "date": "2012-06-22", "storage_temperature": 4.0, "cell_temperature": 20.0, "exposure_time": 30.0, "number_of_frames": 2, "wavelength": 0.1488, "sample_detector_distance": 1.0, "concentration_min": 1.0, "concentration_max": 2.0, "sample_volume": null, "flow_rate": null, "s_min": 0.206, "s_max": 3.684, "total_exposure_time": null, "seccolumn": null }, "fits": [], "estimated_volume_method": null, "pddf_software": "ATSAS GNOM", "pddf_software_version": "GNOM v4.5a", "i0_calibration_standard": null, "description": "Samples were measured at 1 mg/mL and 2 mg/mL in 1 mm path-length mica cells.\r\nAll curves were inspected for X-ray damage and aggregation.\r\nThe experimental molecular weight was determined by analytical ultracentrifugation.", "experiment_description": "Synchrotron SAXS data from solutions of truncated human p23 (1-142) in 25 mM Tris-HCl, 100 mM NaCl, 5 mM β-mercaptoethanol, pH 7.5, were collected on the SAXS1 Beamline at the Brazilian Synchrotron Light Laboratory (Campinas, Brazil) using a 20Hz Pilatus 300K detector at a sample-detector distance of 1 m and at a wavelength of λ = 0.1488 nm (I(s) vs s, where s = 4π sin θ/λ and 2θ is the scattering angle). Solute concentrations ranging between 1 and 2 mg/ml were measured at 20°C. Two successive 30 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.", "tags": [], "intensity_unit": null, "experimental_mw": 20.0, "experimental_mw_error": null, "guinier_i0_mw": null, "guinier_i0_mw_error": null, "porod_mw": null, "porod_mw_error": null, "pddf_i0": 0.01582, "pddf_i0_error": 2e-05, "guinier_i0": 0.01565, "guinier_i0_error": 2e-05, "pddf_rg": 2.237, "pddf_rg_error": 0.007, "guinier_rg": 2.14, "guinier_rg_error": 0.05, "pddf_dmax": 8.5, "pddf_dmax_error": null, "porod_volume": 36.0, "porod_volume_error": null, "estimated_volume": null, "estimated_volume_error": null, "guinier_point_first": 1, "guinier_point_last": 32, "pddf_point_first": null, "pddf_point_last": null, "i0_calibration_standard_data": null, "intensities_log_log_plot": "SASDBJ6_datloglog_img.png", "symmetry": null, "last_modified": "2019-12-06T13:07:15.624532+01:00", "bragg_peak": [] }