data_SASDBJ6_MAIN # _sas_result.id 401 _sas_result.SASBDB_code SASDBJ6 _sas_result.experimental_MW 20.000 _sas_result.experimental_MW_error . _sas_result.MW_standard . _sas_result.MW_standard_error . _sas_result.MW_Porod . _sas_result.MW_Porod_error . _sas_result.I0_from_PR 0.0158200000 _sas_result.I0_from_PR_error 0.0000200000 _sas_result.I0_from_Guinier 0.0156500000 _sas_result.I0_from_Guinier_error 0.0000200000 _sas_result.Rg_from_PR 2.237 _sas_result.Rg_from_PR_error 0.007 _sas_result.Rg_from_Guinier 2.140 _sas_result.Rg_from_Guinier_error 0.050 _sas_result.D_max 8.50 _sas_result.Porod_volume 36.00 _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min 1 _sas_result.Guinier_point_max 32 _sas_result.type_of_curve single_conc _sas_result.standard . _sas_result.Dmax_error . _sas_result.comments ;Samples were measured at 1 mg/mL and 2 mg/mL in 1 mm path-length mica cells. All curves were inspected for X-ray damage and aggregation. The experimental molecular weight was determined by analytical ultracentrifugation. ; # _sas_scan.title "Truncated construct of human p23 (1-142)" _sas_scan.detc_id 10 _sas_scan.id 401 _sas_scan.measurement_date 2012-06-22 _sas_scan.storage_temperature 4.0 _sas_scan.cell_temperature 20.0 _sas_scan.exposure_time 30.000 _sas_scan.number_of_frames 2 _sas_scan.unit 1/A _sas_scan.qmin 0.0206 _sas_scan.qmax 0.3684 _sas_scan.sample_id 363 _sas_scan.result_id 401 _sas_scan.beam_id 28 # _sas_beam.id 28 _sas_beam.instrument_name "Brazilian Synchrotron Light Laboratory SAXS1 Beamline" _sas_beam.instrument_city Campinas _sas_beam.instrument_country Brazil _sas_beam.shape . _sas_beam.type_of_source "X-ray synchrotron" _sas_beam.radiation_wavelength 0.148800 _sas_beam.dist_spec_to_detc 1.00000 # _sas_detc.id 10 _sas_detc.name "Pilatus 300K" _sas_detc.type 20Hz _sas_detc.pixsize_x . # _sas_sample.id 363 _sas_sample.name "Truncated construct of human p23 (1-142)" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration 1.00-2.00 _sas_sample.concentration_method . _sas_sample.entity_id 405 # _sas_buffer.id 202 _sas_buffer.name "25 mM Tris-HCl, 100 mM NaCl, 5 mM B-mercaptoethanol" _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.500 _sas_buffer.comment . _sas_buffer.composition . _sas_buffer.sample_id 363 # _entity.id 405 _entity.type protein _entity.pdbx_description "Prostaglandin E synthase 3 (1-142)" _entity.formula_weight 16.877 _entity.pdbx_number_of_molecules 1 # _entity_name_com.entity_id 405 _entity_name_com.name "PTGES, Sba1, p23" # _entity_poly.entity_id 405 _entity_poly.pdbx_seq_one_letter_code ;GSMQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID PNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNF DRFSEMMNNMGGDEDVDLPEVD ; # _entity_src_gen.entity_id 405 _entity_src_gen.gene_src_common_name "Homo sapiens" # _struct_ref.id 1 _struct_ref.entity_id 405 _struct_ref.db_name UniProt _struct_ref.db_code Q15185 _struct_ref.details http://www.uniprot.org/uniprot/Q15185 # _citation.id 196 _citation.title "The C-terminal region of the human p23 chaperone modulates its structure and function." _citation.year "2015 Jan 1" _citation.pdbx_database_id_DOI 10.1016/j.abb.2014.10.015 _citation.pdbx_database_id_PubMed 25447839 _citation.journal_abbrev "Arch Biochem Biophys" _citation.journal_volume 565 _citation.page_first 57 _citation.page_last 67 # loop_ _citation_author.citation_id _citation_author.ordinal _citation_author.name 196 1 "Seraphim TV" 196 2 "Gava LM" 196 3 "Mokry DZ" 196 4 "Cagliari TC" 196 5 "Barbosa LR" 196 6 "Ramos CH" # _pdbx_contact_author.id 103 _pdbx_contact_author.name_first Júlio _pdbx_contact_author.name_last Borges _pdbx_contact_author.role . _pdbx_contact_author.address_1 . _pdbx_contact_author.address_2 "Instituto de Química de São Carlos" _pdbx_contact_author.address_3 "São Carlos - SP - Brasil" # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 2.059000E-02 1.461000E-02 0.000000E+00 401 2 2.185000E-02 1.430000E-02 0.000000E+00 401 3 2.310000E-02 1.444000E-02 0.000000E+00 401 4 2.436000E-02 1.427000E-02 0.000000E+00 401 5 2.561000E-02 1.407000E-02 0.000000E+00 401 6 2.687000E-02 1.398000E-02 0.000000E+00 401 7 2.812000E-02 1.391000E-02 0.000000E+00 401 8 2.938000E-02 1.382000E-02 0.000000E+00 401 9 3.063000E-02 1.352000E-02 0.000000E+00 401 10 3.189000E-02 1.341000E-02 0.000000E+00 401 11 3.315000E-02 1.322000E-02 0.000000E+00 401 12 3.440000E-02 1.306000E-02 0.000000E+00 401 13 3.566000E-02 1.294000E-02 0.000000E+00 401 14 3.691000E-02 1.276000E-02 0.000000E+00 401 15 3.817000E-02 1.256000E-02 0.000000E+00 401 16 3.942000E-02 1.247000E-02 0.000000E+00 401 17 4.068000E-02 1.218000E-02 0.000000E+00 401 18 4.193000E-02 1.195000E-02 0.000000E+00 401 19 4.319000E-02 1.172000E-02 0.000000E+00 401 20 4.445000E-02 1.146000E-02 0.000000E+00 401 21 4.570000E-02 1.131000E-02 0.000000E+00 401 22 4.696000E-02 1.114000E-02 0.000000E+00 401 23 4.821000E-02 1.084000E-02 0.000000E+00 401 24 4.947000E-02 1.076000E-02 0.000000E+00 401 25 5.072000E-02 1.052000E-02 0.000000E+00 401 26 5.198000E-02 1.024000E-02 0.000000E+00 401 27 5.323000E-02 1.007000E-02 0.000000E+00 401 28 5.449000E-02 1.002000E-02 0.000000E+00 401 29 5.574000E-02 9.750000E-03 0.000000E+00 401 30 5.700000E-02 9.567000E-03 0.000000E+00 401 31 5.826000E-02 9.412000E-03 0.000000E+00 401 32 5.951000E-02 9.105000E-03 0.000000E+00 401 33 6.077000E-02 8.926000E-03 0.000000E+00 401 34 6.202000E-02 8.750000E-03 0.000000E+00 401 35 6.328000E-02 8.557000E-03 0.000000E+00 401 36 6.453000E-02 8.433000E-03 0.000000E+00 401 37 6.579000E-02 8.155000E-03 0.000000E+00 401 38 6.704000E-02 8.015000E-03 0.000000E+00 401 39 6.830000E-02 7.857000E-03 0.000000E+00 401 40 6.956000E-02 7.634000E-03 0.000000E+00 401 41 7.081000E-02 7.494000E-03 0.000000E+00 401 42 7.207000E-02 7.260000E-03 0.000000E+00 401 43 7.332000E-02 7.119000E-03 0.000000E+00 401 44 7.458000E-02 6.874000E-03 0.000000E+00 401 45 7.583000E-02 6.782000E-03 0.000000E+00 401 46 7.709000E-02 6.646000E-03 0.000000E+00 401 47 7.834000E-02 6.489000E-03 0.000000E+00 401 48 7.960000E-02 6.294000E-03 0.000000E+00 401 49 8.085000E-02 6.114000E-03 0.000000E+00 401 50 8.211000E-02 5.924000E-03 0.000000E+00 401 51 8.337000E-02 5.824000E-03 0.000000E+00 401 52 8.462000E-02 5.657000E-03 0.000000E+00 401 53 8.588000E-02 5.585000E-03 0.000000E+00 401 54 8.713000E-02 5.495000E-03 0.000000E+00 401 55 8.839000E-02 5.282000E-03 0.000000E+00 401 56 8.964000E-02 5.074000E-03 0.000000E+00 401 57 9.090000E-02 4.957000E-03 0.000000E+00 401 58 9.215000E-02 4.858000E-03 0.000000E+00 401 59 9.341000E-02 4.765000E-03 0.000000E+00 401 60 9.466000E-02 4.648000E-03 0.000000E+00 401 61 9.592000E-02 4.485000E-03 0.000000E+00 401 62 9.718000E-02 4.382000E-03 0.000000E+00 401 63 9.843000E-02 4.227000E-03 0.000000E+00 401 64 9.969000E-02 4.130000E-03 0.000000E+00 401 65 1.009000E-01 4.011000E-03 0.000000E+00 401 66 1.022000E-01 3.883000E-03 0.000000E+00 401 67 1.035000E-01 3.771000E-03 0.000000E+00 401 68 1.047000E-01 3.678000E-03 0.000000E+00 401 69 1.060000E-01 3.612000E-03 0.000000E+00 401 70 1.072000E-01 3.489000E-03 0.000000E+00 401 71 1.085000E-01 3.431000E-03 0.000000E+00 401 72 1.097000E-01 3.324000E-03 0.000000E+00 401 73 1.110000E-01 3.220000E-03 0.000000E+00 401 74 1.122000E-01 3.098000E-03 0.000000E+00 401 75 1.135000E-01 2.985000E-03 0.000000E+00 401 76 1.148000E-01 2.953000E-03 0.000000E+00 401 77 1.160000E-01 2.835000E-03 0.000000E+00 401 78 1.173000E-01 2.777000E-03 0.000000E+00 401 79 1.185000E-01 2.649000E-03 0.000000E+00 401 80 1.198000E-01 2.580000E-03 0.000000E+00 401 81 1.210000E-01 2.559000E-03 0.000000E+00 401 82 1.223000E-01 2.487000E-03 0.000000E+00 401 83 1.235000E-01 2.401000E-03 0.000000E+00 401 84 1.248000E-01 2.349000E-03 0.000000E+00 401 85 1.261000E-01 2.283000E-03 0.000000E+00 401 86 1.273000E-01 2.183000E-03 0.000000E+00 401 87 1.286000E-01 2.105000E-03 0.000000E+00 401 88 1.298000E-01 2.071000E-03 0.000000E+00 401 89 1.311000E-01 1.980000E-03 0.000000E+00 401 90 1.323000E-01 1.939000E-03 0.000000E+00 401 91 1.336000E-01 1.804000E-03 0.000000E+00 401 92 1.348000E-01 1.805000E-03 0.000000E+00 401 93 1.361000E-01 1.781000E-03 0.000000E+00 401 94 1.374000E-01 1.675000E-03 0.000000E+00 401 95 1.386000E-01 1.650000E-03 0.000000E+00 401 96 1.399000E-01 1.572000E-03 0.000000E+00 401 97 1.411000E-01 1.533000E-03 0.000000E+00 401 98 1.424000E-01 1.503000E-03 0.000000E+00 401 99 1.436000E-01 1.483000E-03 0.000000E+00 401 100 1.449000E-01 1.416000E-03 0.000000E+00 401 101 1.461000E-01 1.362000E-03 0.000000E+00 401 102 1.474000E-01 1.361000E-03 0.000000E+00 401 103 1.487000E-01 1.265000E-03 0.000000E+00 401 104 1.499000E-01 1.240000E-03 0.000000E+00 401 105 1.512000E-01 1.178000E-03 0.000000E+00 401 106 1.524000E-01 1.125000E-03 0.000000E+00 401 107 1.537000E-01 1.104000E-03 0.000000E+00 401 108 1.549000E-01 1.039000E-03 0.000000E+00 401 109 1.562000E-01 1.053000E-03 0.000000E+00 401 110 1.574000E-01 9.994000E-04 0.000000E+00 401 111 1.587000E-01 9.975000E-04 0.000000E+00 401 112 1.600000E-01 9.374000E-04 0.000000E+00 401 113 1.612000E-01 9.216000E-04 0.000000E+00 401 114 1.625000E-01 8.356000E-04 0.000000E+00 401 115 1.637000E-01 8.559000E-04 0.000000E+00 401 116 1.650000E-01 8.327000E-04 0.000000E+00 401 117 1.662000E-01 7.970000E-04 0.000000E+00 401 118 1.675000E-01 8.058000E-04 0.000000E+00 401 119 1.687000E-01 7.757000E-04 0.000000E+00 401 120 1.700000E-01 7.433000E-04 0.000000E+00 401 121 1.713000E-01 7.070000E-04 0.000000E+00 401 122 1.725000E-01 6.856000E-04 0.000000E+00 401 123 1.738000E-01 6.447000E-04 0.000000E+00 401 124 1.750000E-01 6.305000E-04 0.000000E+00 401 125 1.763000E-01 6.495000E-04 0.000000E+00 401 126 1.775000E-01 5.897000E-04 0.000000E+00 401 127 1.788000E-01 6.041000E-04 0.000000E+00 401 128 1.800000E-01 6.061000E-04 0.000000E+00 401 129 1.813000E-01 5.675000E-04 0.000000E+00 401 130 1.825000E-01 5.397000E-04 0.000000E+00 401 131 1.838000E-01 5.283000E-04 0.000000E+00 401 132 1.851000E-01 5.186000E-04 0.000000E+00 401 133 1.863000E-01 4.860000E-04 0.000000E+00 401 134 1.876000E-01 4.530000E-04 0.000000E+00 401 135 1.888000E-01 4.441000E-04 0.000000E+00 401 136 1.901000E-01 4.074000E-04 0.000000E+00 401 137 1.913000E-01 4.266000E-04 0.000000E+00 401 138 1.926000E-01 3.661000E-04 0.000000E+00 401 139 1.938000E-01 3.938000E-04 0.000000E+00 401 140 1.951000E-01 3.974000E-04 0.000000E+00 401 141 1.964000E-01 3.915000E-04 0.000000E+00 401 142 1.976000E-01 3.483000E-04 0.000000E+00 401 143 1.989000E-01 3.656000E-04 0.000000E+00 401 144 2.001000E-01 3.586000E-04 0.000000E+00 401 145 2.014000E-01 3.443000E-04 0.000000E+00 401 146 2.026000E-01 3.137000E-04 0.000000E+00 401 147 2.039000E-01 3.120000E-04 0.000000E+00 401 148 2.051000E-01 3.295000E-04 0.000000E+00 401 149 2.064000E-01 3.125000E-04 0.000000E+00 401 150 2.077000E-01 2.746000E-04 0.000000E+00 401 151 2.089000E-01 2.735000E-04 0.000000E+00 401 152 2.102000E-01 2.895000E-04 0.000000E+00 401 153 2.114000E-01 2.891000E-04 0.000000E+00 401 154 2.127000E-01 2.574000E-04 0.000000E+00 401 155 2.139000E-01 2.327000E-04 0.000000E+00 401 156 2.152000E-01 2.888000E-04 0.000000E+00 401 157 2.164000E-01 2.541000E-04 0.000000E+00 401 158 2.177000E-01 2.556000E-04 0.000000E+00 401 159 2.190000E-01 1.972000E-04 0.000000E+00 401 160 2.202000E-01 2.346000E-04 0.000000E+00 401 161 2.215000E-01 2.261000E-04 0.000000E+00 401 162 2.227000E-01 1.847000E-04 0.000000E+00 401 163 2.240000E-01 1.758000E-04 0.000000E+00 401 164 2.252000E-01 1.971000E-04 0.000000E+00 401 165 2.265000E-01 2.216000E-04 0.000000E+00 401 166 2.277000E-01 2.001000E-04 0.000000E+00 401 167 2.290000E-01 2.050000E-04 0.000000E+00 401 168 2.303000E-01 1.968000E-04 0.000000E+00 401 169 2.315000E-01 1.795000E-04 0.000000E+00 401 170 2.328000E-01 1.666000E-04 0.000000E+00 401 171 2.340000E-01 1.982000E-04 0.000000E+00 401 172 2.353000E-01 1.814000E-04 0.000000E+00 401 173 2.365000E-01 1.524000E-04 0.000000E+00 401 174 2.378000E-01 1.907000E-04 0.000000E+00 401 175 2.390000E-01 1.708000E-04 0.000000E+00 401 176 2.403000E-01 1.339000E-04 0.000000E+00 401 177 2.416000E-01 1.616000E-04 0.000000E+00 401 178 2.428000E-01 1.938000E-04 0.000000E+00 401 179 2.441000E-01 1.597000E-04 0.000000E+00 401 180 2.453000E-01 1.858000E-04 0.000000E+00 401 181 2.466000E-01 1.661000E-04 0.000000E+00 401 182 2.478000E-01 1.513000E-04 0.000000E+00 401 183 2.491000E-01 1.678000E-04 0.000000E+00 401 184 2.503000E-01 1.486000E-04 0.000000E+00 401 185 2.516000E-01 1.508000E-04 0.000000E+00 401 186 2.529000E-01 1.752000E-04 0.000000E+00 401 187 2.541000E-01 1.659000E-04 0.000000E+00 401 188 2.554000E-01 1.403000E-04 0.000000E+00 401 189 2.566000E-01 1.421000E-04 0.000000E+00 401 190 2.579000E-01 1.316000E-04 0.000000E+00 401 191 2.591000E-01 1.717000E-04 0.000000E+00 401 192 2.604000E-01 1.614000E-04 0.000000E+00 401 193 2.616000E-01 1.827000E-04 0.000000E+00 401 194 2.629000E-01 1.691000E-04 0.000000E+00 401 195 2.642000E-01 1.428000E-04 0.000000E+00 401 196 2.654000E-01 1.300000E-04 0.000000E+00 401 197 2.667000E-01 1.337000E-04 0.000000E+00 401 198 2.679000E-01 1.242000E-04 0.000000E+00 401 199 2.692000E-01 1.608000E-04 0.000000E+00 401 200 2.704000E-01 1.545000E-04 0.000000E+00 401 201 2.717000E-01 1.249000E-04 0.000000E+00 401 202 2.729000E-01 1.543000E-04 0.000000E+00 401 203 2.742000E-01 9.802000E-05 0.000000E+00 401 204 2.755000E-01 1.333000E-04 0.000000E+00 401 205 2.767000E-01 1.383000E-04 0.000000E+00 401 206 2.780000E-01 1.343000E-04 0.000000E+00 401 207 2.792000E-01 1.438000E-04 0.000000E+00 401 208 2.805000E-01 1.438000E-04 0.000000E+00 401 209 2.817000E-01 1.187000E-04 0.000000E+00 401 210 2.830000E-01 1.340000E-04 0.000000E+00 401 211 2.842000E-01 1.122000E-04 0.000000E+00 401 212 2.855000E-01 1.355000E-04 0.000000E+00 401 213 2.868000E-01 1.507000E-04 0.000000E+00 401 214 2.880000E-01 8.384000E-05 0.000000E+00 401 215 2.893000E-01 1.064000E-04 0.000000E+00 401 216 2.905000E-01 1.002000E-04 0.000000E+00 401 217 2.918000E-01 1.384000E-04 0.000000E+00 401 218 2.930000E-01 1.461000E-04 0.000000E+00 401 219 2.943000E-01 1.164000E-04 0.000000E+00 401 220 2.955000E-01 1.633000E-04 0.000000E+00 401 221 2.968000E-01 1.669000E-04 0.000000E+00 401 222 2.981000E-01 1.045000E-04 0.000000E+00 401 223 2.993000E-01 1.220000E-04 0.000000E+00 401 224 3.006000E-01 1.022000E-04 0.000000E+00 401 225 3.018000E-01 1.395000E-04 0.000000E+00 401 226 3.031000E-01 1.374000E-04 0.000000E+00 401 227 3.043000E-01 1.120000E-04 0.000000E+00 401 228 3.056000E-01 1.034000E-04 0.000000E+00 401 229 3.068000E-01 1.249000E-04 0.000000E+00 401 230 3.081000E-01 1.138000E-04 0.000000E+00 401 231 3.094000E-01 1.162000E-04 0.000000E+00 401 232 3.106000E-01 1.521000E-04 0.000000E+00 401 233 3.119000E-01 1.439000E-04 0.000000E+00 401 234 3.131000E-01 1.375000E-04 0.000000E+00 401 235 3.144000E-01 1.299000E-04 0.000000E+00 401 236 3.156000E-01 1.265000E-04 0.000000E+00 401 237 3.169000E-01 1.272000E-04 0.000000E+00 401 238 3.181000E-01 1.225000E-04 0.000000E+00 401 239 3.194000E-01 1.068000E-04 0.000000E+00 401 240 3.207000E-01 8.853000E-05 0.000000E+00 401 241 3.219000E-01 1.012000E-04 0.000000E+00 401 242 3.232000E-01 1.438000E-04 0.000000E+00 401 243 3.244000E-01 8.952000E-05 0.000000E+00 401 244 3.257000E-01 1.138000E-04 0.000000E+00 401 245 3.269000E-01 9.100000E-05 0.000000E+00 401 246 3.282000E-01 1.212000E-04 0.000000E+00 401 247 3.294000E-01 1.379000E-04 0.000000E+00 401 248 3.307000E-01 1.207000E-04 0.000000E+00 401 249 3.320000E-01 1.178000E-04 0.000000E+00 401 250 3.332000E-01 1.087000E-04 0.000000E+00 401 251 3.345000E-01 1.094000E-04 0.000000E+00 401 252 3.357000E-01 1.450000E-04 0.000000E+00 401 253 3.370000E-01 1.080000E-04 0.000000E+00 401 254 3.382000E-01 9.395000E-05 0.000000E+00 401 255 3.395000E-01 1.517000E-04 0.000000E+00 401 256 3.407000E-01 1.339000E-04 0.000000E+00 401 257 3.420000E-01 1.052000E-04 0.000000E+00 401 258 3.433000E-01 1.033000E-04 0.000000E+00 401 259 3.445000E-01 1.021000E-04 0.000000E+00 401 260 3.458000E-01 9.719000E-05 0.000000E+00 401 261 3.470000E-01 1.180000E-04 0.000000E+00 401 262 3.483000E-01 1.379000E-04 0.000000E+00 401 263 3.495000E-01 1.065000E-04 0.000000E+00 401 264 3.508000E-01 8.270000E-05 0.000000E+00 401 265 3.520000E-01 1.092000E-04 0.000000E+00 401 266 3.533000E-01 1.127000E-04 0.000000E+00 401 267 3.546000E-01 1.210000E-04 0.000000E+00 401 268 3.558000E-01 1.369000E-04 0.000000E+00 401 269 3.571000E-01 1.137000E-04 0.000000E+00 401 270 3.583000E-01 7.291000E-05 0.000000E+00 401 271 3.596000E-01 1.196000E-04 0.000000E+00 401 272 3.608000E-01 1.148000E-04 0.000000E+00 401 273 3.621000E-01 1.057000E-04 0.000000E+00 401 274 3.633000E-01 1.640000E-04 0.000000E+00 401 275 3.646000E-01 1.383000E-04 0.000000E+00 401 276 3.659000E-01 1.317000E-04 0.000000E+00 401 277 3.671000E-01 1.327000E-04 0.000000E+00 401 278 3.684000E-01 8.317000E-05 0.000000E+00 401 # _sas_p_of_R_details.id 401 _sas_p_of_R_details.intensity_id 401 _sas_p_of_R_details.software_p_of_R "GNOM 4.6" _sas_p_of_R_details.number_of_points 278 _sas_p_of_R_details.qmin 0.02059 _sas_p_of_R_details.qmax 0.3684 _sas_p_of_R_details.p_of_R_point_min 1 _sas_p_of_R_details.p_of_R_point_max 278 _sas_p_of_R_details.Rmin 0.0 _sas_p_of_R_details.Rmax 85.0 # loop_ _sas_p_of_R.id _sas_p_of_R.ordinal _sas_p_of_R.r _sas_p_of_R.P _sas_p_of_R.P_error 401 1 0.000000E+00 0.000000E+00 0.000000E+00 401 2 6.538000E-01 8.077000E-07 2.277000E-08 401 3 1.308000E+00 1.688000E-06 3.780000E-08 401 4 1.962000E+00 2.641000E-06 4.555000E-08 401 5 2.615000E+00 3.667000E-06 4.674000E-08 401 6 3.269000E+00 4.767000E-06 4.238000E-08 401 7 3.923000E+00 5.942000E-06 3.384000E-08 401 8 4.577000E+00 7.192000E-06 2.320000E-08 401 9 5.231000E+00 8.516000E-06 1.578000E-08 401 10 5.885000E+00 9.912000E-06 2.087000E-08 401 11 6.538000E+00 1.138000E-05 3.326000E-08 401 12 7.192000E+00 1.291000E-05 4.612000E-08 401 13 7.846000E+00 1.451000E-05 5.713000E-08 401 14 8.500000E+00 1.616000E-05 6.520000E-08 401 15 9.154000E+00 1.786000E-05 6.971000E-08 401 16 9.808000E+00 1.959000E-05 7.041000E-08 401 17 1.046000E+01 2.135000E-05 6.737000E-08 401 18 1.112000E+01 2.311000E-05 6.106000E-08 401 19 1.177000E+01 2.487000E-05 5.241000E-08 401 20 1.242000E+01 2.661000E-05 4.315000E-08 401 21 1.308000E+01 2.832000E-05 3.634000E-08 401 22 1.373000E+01 2.996000E-05 3.597000E-08 401 23 1.438000E+01 3.154000E-05 4.285000E-08 401 24 1.504000E+01 3.303000E-05 5.357000E-08 401 25 1.569000E+01 3.441000E-05 6.485000E-08 401 26 1.635000E+01 3.567000E-05 7.471000E-08 401 27 1.700000E+01 3.680000E-05 8.200000E-08 401 28 1.765000E+01 3.779000E-05 8.604000E-08 401 29 1.831000E+01 3.862000E-05 8.657000E-08 401 30 1.896000E+01 3.930000E-05 8.362000E-08 401 31 1.962000E+01 3.981000E-05 7.762000E-08 401 32 2.027000E+01 4.016000E-05 6.942000E-08 401 33 2.092000E+01 4.035000E-05 6.042000E-08 401 34 2.158000E+01 4.038000E-05 5.280000E-08 401 35 2.223000E+01 4.026000E-05 4.932000E-08 401 36 2.288000E+01 4.000000E-05 5.175000E-08 401 37 2.354000E+01 3.961000E-05 5.907000E-08 401 38 2.419000E+01 3.909000E-05 6.863000E-08 401 39 2.485000E+01 3.847000E-05 7.811000E-08 401 40 2.550000E+01 3.775000E-05 8.599000E-08 401 41 2.615000E+01 3.695000E-05 9.134000E-08 401 42 2.681000E+01 3.609000E-05 9.375000E-08 401 43 2.746000E+01 3.517000E-05 9.317000E-08 401 44 2.812000E+01 3.421000E-05 8.997000E-08 401 45 2.877000E+01 3.322000E-05 8.493000E-08 401 46 2.942000E+01 3.221000E-05 7.926000E-08 401 47 3.008000E+01 3.120000E-05 7.459000E-08 401 48 3.073000E+01 3.018000E-05 7.256000E-08 401 49 3.138000E+01 2.916000E-05 7.421000E-08 401 50 3.204000E+01 2.816000E-05 7.930000E-08 401 51 3.269000E+01 2.718000E-05 8.656000E-08 401 52 3.335000E+01 2.621000E-05 9.438000E-08 401 53 3.400000E+01 2.525000E-05 1.014000E-07 401 54 3.465000E+01 2.432000E-05 1.066000E-07 401 55 3.531000E+01 2.341000E-05 1.094000E-07 401 56 3.596000E+01 2.253000E-05 1.096000E-07 401 57 3.662000E+01 2.166000E-05 1.075000E-07 401 58 3.727000E+01 2.081000E-05 1.036000E-07 401 59 3.792000E+01 1.999000E-05 9.905000E-08 401 60 3.858000E+01 1.918000E-05 9.503000E-08 401 61 3.923000E+01 1.840000E-05 9.293000E-08 401 62 3.988000E+01 1.763000E-05 9.372000E-08 401 63 4.054000E+01 1.689000E-05 9.756000E-08 401 64 4.119000E+01 1.617000E-05 1.037000E-07 401 65 4.185000E+01 1.548000E-05 1.110000E-07 401 66 4.250000E+01 1.480000E-05 1.181000E-07 401 67 4.315000E+01 1.416000E-05 1.240000E-07 401 68 4.381000E+01 1.354000E-05 1.280000E-07 401 69 4.446000E+01 1.295000E-05 1.296000E-07 401 70 4.512000E+01 1.238000E-05 1.289000E-07 401 71 4.577000E+01 1.185000E-05 1.261000E-07 401 72 4.642000E+01 1.134000E-05 1.221000E-07 401 73 4.708000E+01 1.086000E-05 1.176000E-07 401 74 4.773000E+01 1.040000E-05 1.137000E-07 401 75 4.838000E+01 9.972000E-06 1.114000E-07 401 76 4.904000E+01 9.565000E-06 1.113000E-07 401 77 4.969000E+01 9.179000E-06 1.134000E-07 401 78 5.035000E+01 8.812000E-06 1.171000E-07 401 79 5.100000E+01 8.460000E-06 1.214000E-07 401 80 5.165000E+01 8.123000E-06 1.254000E-07 401 81 5.231000E+01 7.796000E-06 1.283000E-07 401 82 5.296000E+01 7.479000E-06 1.294000E-07 401 83 5.362000E+01 7.170000E-06 1.286000E-07 401 84 5.427000E+01 6.865000E-06 1.260000E-07 401 85 5.492000E+01 6.565000E-06 1.222000E-07 401 86 5.558000E+01 6.269000E-06 1.178000E-07 401 87 5.623000E+01 5.976000E-06 1.140000E-07 401 88 5.688000E+01 5.686000E-06 1.116000E-07 401 89 5.754000E+01 5.399000E-06 1.115000E-07 401 90 5.819000E+01 5.118000E-06 1.137000E-07 401 91 5.885000E+01 4.842000E-06 1.180000E-07 401 92 5.950000E+01 4.573000E-06 1.234000E-07 401 93 6.015000E+01 4.313000E-06 1.291000E-07 401 94 6.081000E+01 4.063000E-06 1.342000E-07 401 95 6.146000E+01 3.824000E-06 1.380000E-07 401 96 6.212000E+01 3.599000E-06 1.402000E-07 401 97 6.277000E+01 3.387000E-06 1.409000E-07 401 98 6.342000E+01 3.190000E-06 1.404000E-07 401 99 6.408000E+01 3.009000E-06 1.390000E-07 401 100 6.473000E+01 2.844000E-06 1.376000E-07 401 101 6.538000E+01 2.694000E-06 1.368000E-07 401 102 6.604000E+01 2.558000E-06 1.373000E-07 401 103 6.669000E+01 2.437000E-06 1.392000E-07 401 104 6.735000E+01 2.329000E-06 1.426000E-07 401 105 6.800000E+01 2.232000E-06 1.472000E-07 401 106 6.865000E+01 2.145000E-06 1.525000E-07 401 107 6.931000E+01 2.065000E-06 1.579000E-07 401 108 6.996000E+01 1.992000E-06 1.629000E-07 401 109 7.062000E+01 1.923000E-06 1.671000E-07 401 110 7.127000E+01 1.856000E-06 1.704000E-07 401 111 7.192000E+01 1.790000E-06 1.726000E-07 401 112 7.258000E+01 1.723000E-06 1.740000E-07 401 113 7.323000E+01 1.653000E-06 1.746000E-07 401 114 7.388000E+01 1.580000E-06 1.747000E-07 401 115 7.454000E+01 1.502000E-06 1.746000E-07 401 116 7.519000E+01 1.419000E-06 1.745000E-07 401 117 7.585000E+01 1.330000E-06 1.749000E-07 401 118 7.650000E+01 1.235000E-06 1.760000E-07 401 119 7.715000E+01 1.135000E-06 1.781000E-07 401 120 7.781000E+01 1.029000E-06 1.814000E-07 401 121 7.846000E+01 9.187000E-07 1.859000E-07 401 122 7.912000E+01 8.048000E-07 1.910000E-07 401 123 7.977000E+01 6.888000E-07 1.960000E-07 401 124 8.042000E+01 5.726000E-07 1.997000E-07 401 125 8.108000E+01 4.583000E-07 2.001000E-07 401 126 8.173000E+01 3.487000E-07 1.952000E-07 401 127 8.238000E+01 2.469000E-07 1.826000E-07 401 128 8.304000E+01 1.566000E-07 1.596000E-07 401 129 8.369000E+01 8.211000E-08 1.235000E-07 401 130 8.435000E+01 2.812000E-08 7.120000E-08 401 131 8.500000E+01 0.000000E+00 0.000000E+00 # loop_ _sas_p_of_R_extrapolated_intensity.id _sas_p_of_R_extrapolated_intensity.ordinal _sas_p_of_R_extrapolated_intensity.momentum_transfer _sas_p_of_R_extrapolated_intensity.intensity_reg 401 1 0.000000E+00 1.582000E-02 401 2 1.287000E-03 1.582000E-02 401 3 2.574000E-03 1.581000E-02 401 4 3.861000E-03 1.578000E-02 401 5 5.148000E-03 1.575000E-02 401 6 6.435000E-03 1.571000E-02 401 7 7.722000E-03 1.567000E-02 401 8 9.008000E-03 1.561000E-02 401 9 1.030000E-02 1.555000E-02 401 10 1.158000E-02 1.547000E-02 401 11 1.287000E-02 1.539000E-02 401 12 1.416000E-02 1.530000E-02 401 13 1.544000E-02 1.521000E-02 401 14 1.673000E-02 1.510000E-02 401 15 1.802000E-02 1.499000E-02 401 16 1.930000E-02 1.488000E-02 401 17 2.059000E-02 1.475000E-02 401 18 2.185000E-02 1.462000E-02 401 19 2.310000E-02 1.449000E-02 401 20 2.436000E-02 1.435000E-02 401 21 2.561000E-02 1.420000E-02 401 22 2.687000E-02 1.405000E-02 401 23 2.812000E-02 1.390000E-02 401 24 2.938000E-02 1.374000E-02 401 25 3.063000E-02 1.357000E-02 401 26 3.189000E-02 1.340000E-02 401 27 3.315000E-02 1.323000E-02 401 28 3.440000E-02 1.305000E-02 401 29 3.566000E-02 1.287000E-02 401 30 3.691000E-02 1.269000E-02 401 31 3.817000E-02 1.250000E-02 401 32 3.942000E-02 1.231000E-02 401 33 4.068000E-02 1.212000E-02 401 34 4.193000E-02 1.193000E-02 401 35 4.319000E-02 1.173000E-02 401 36 4.445000E-02 1.153000E-02 401 37 4.570000E-02 1.134000E-02 401 38 4.696000E-02 1.114000E-02 401 39 4.821000E-02 1.094000E-02 401 40 4.947000E-02 1.074000E-02 401 41 5.072000E-02 1.054000E-02 401 42 5.198000E-02 1.034000E-02 401 43 5.323000E-02 1.014000E-02 401 44 5.449000E-02 9.939000E-03 401 45 5.574000E-02 9.741000E-03 401 46 5.700000E-02 9.543000E-03 401 47 5.826000E-02 9.346000E-03 401 48 5.951000E-02 9.151000E-03 401 49 6.077000E-02 8.956000E-03 401 50 6.202000E-02 8.764000E-03 401 51 6.328000E-02 8.573000E-03 401 52 6.453000E-02 8.384000E-03 401 53 6.579000E-02 8.196000E-03 401 54 6.704000E-02 8.011000E-03 401 55 6.830000E-02 7.829000E-03 401 56 6.956000E-02 7.648000E-03 401 57 7.081000E-02 7.470000E-03 401 58 7.207000E-02 7.294000E-03 401 59 7.332000E-02 7.121000E-03 401 60 7.458000E-02 6.950000E-03 401 61 7.583000E-02 6.783000E-03 401 62 7.709000E-02 6.617000E-03 401 63 7.834000E-02 6.455000E-03 401 64 7.960000E-02 6.295000E-03 401 65 8.085000E-02 6.139000E-03 401 66 8.211000E-02 5.985000E-03 401 67 8.337000E-02 5.834000E-03 401 68 8.462000E-02 5.685000E-03 401 69 8.588000E-02 5.540000E-03 401 70 8.713000E-02 5.398000E-03 401 71 8.839000E-02 5.258000E-03 401 72 8.964000E-02 5.121000E-03 401 73 9.090000E-02 4.987000E-03 401 74 9.215000E-02 4.856000E-03 401 75 9.341000E-02 4.728000E-03 401 76 9.466000E-02 4.602000E-03 401 77 9.592000E-02 4.479000E-03 401 78 9.718000E-02 4.359000E-03 401 79 9.843000E-02 4.241000E-03 401 80 9.969000E-02 4.126000E-03 401 81 1.009000E-01 4.014000E-03 401 82 1.022000E-01 3.904000E-03 401 83 1.035000E-01 3.797000E-03 401 84 1.047000E-01 3.692000E-03 401 85 1.060000E-01 3.590000E-03 401 86 1.072000E-01 3.490000E-03 401 87 1.085000E-01 3.392000E-03 401 88 1.097000E-01 3.296000E-03 401 89 1.110000E-01 3.203000E-03 401 90 1.122000E-01 3.112000E-03 401 91 1.135000E-01 3.023000E-03 401 92 1.148000E-01 2.937000E-03 401 93 1.160000E-01 2.852000E-03 401 94 1.173000E-01 2.770000E-03 401 95 1.185000E-01 2.689000E-03 401 96 1.198000E-01 2.611000E-03 401 97 1.210000E-01 2.534000E-03 401 98 1.223000E-01 2.459000E-03 401 99 1.235000E-01 2.386000E-03 401 100 1.248000E-01 2.315000E-03 401 101 1.261000E-01 2.246000E-03 401 102 1.273000E-01 2.179000E-03 401 103 1.286000E-01 2.113000E-03 401 104 1.298000E-01 2.049000E-03 401 105 1.311000E-01 1.987000E-03 401 106 1.323000E-01 1.926000E-03 401 107 1.336000E-01 1.867000E-03 401 108 1.348000E-01 1.809000E-03 401 109 1.361000E-01 1.753000E-03 401 110 1.374000E-01 1.699000E-03 401 111 1.386000E-01 1.646000E-03 401 112 1.399000E-01 1.594000E-03 401 113 1.411000E-01 1.544000E-03 401 114 1.424000E-01 1.496000E-03 401 115 1.436000E-01 1.448000E-03 401 116 1.449000E-01 1.402000E-03 401 117 1.461000E-01 1.358000E-03 401 118 1.474000E-01 1.315000E-03 401 119 1.487000E-01 1.273000E-03 401 120 1.499000E-01 1.232000E-03 401 121 1.512000E-01 1.193000E-03 401 122 1.524000E-01 1.154000E-03 401 123 1.537000E-01 1.117000E-03 401 124 1.549000E-01 1.081000E-03 401 125 1.562000E-01 1.047000E-03 401 126 1.574000E-01 1.013000E-03 401 127 1.587000E-01 9.803000E-04 401 128 1.600000E-01 9.488000E-04 401 129 1.612000E-01 9.182000E-04 401 130 1.625000E-01 8.887000E-04 401 131 1.637000E-01 8.601000E-04 401 132 1.650000E-01 8.325000E-04 401 133 1.662000E-01 8.058000E-04 401 134 1.675000E-01 7.800000E-04 401 135 1.687000E-01 7.550000E-04 401 136 1.700000E-01 7.309000E-04 401 137 1.713000E-01 7.076000E-04 401 138 1.725000E-01 6.851000E-04 401 139 1.738000E-01 6.634000E-04 401 140 1.750000E-01 6.425000E-04 401 141 1.763000E-01 6.222000E-04 401 142 1.775000E-01 6.026000E-04 401 143 1.788000E-01 5.837000E-04 401 144 1.800000E-01 5.655000E-04 401 145 1.813000E-01 5.479000E-04 401 146 1.825000E-01 5.309000E-04 401 147 1.838000E-01 5.145000E-04 401 148 1.851000E-01 4.987000E-04 401 149 1.863000E-01 4.834000E-04 401 150 1.876000E-01 4.687000E-04 401 151 1.888000E-01 4.545000E-04 401 152 1.901000E-01 4.408000E-04 401 153 1.913000E-01 4.275000E-04 401 154 1.926000E-01 4.148000E-04 401 155 1.938000E-01 4.025000E-04 401 156 1.951000E-01 3.906000E-04 401 157 1.964000E-01 3.791000E-04 401 158 1.976000E-01 3.681000E-04 401 159 1.989000E-01 3.575000E-04 401 160 2.001000E-01 3.472000E-04 401 161 2.014000E-01 3.373000E-04 401 162 2.026000E-01 3.278000E-04 401 163 2.039000E-01 3.187000E-04 401 164 2.051000E-01 3.098000E-04 401 165 2.064000E-01 3.014000E-04 401 166 2.077000E-01 2.932000E-04 401 167 2.089000E-01 2.854000E-04 401 168 2.102000E-01 2.779000E-04 401 169 2.114000E-01 2.706000E-04 401 170 2.127000E-01 2.637000E-04 401 171 2.139000E-01 2.571000E-04 401 172 2.152000E-01 2.507000E-04 401 173 2.164000E-01 2.446000E-04 401 174 2.177000E-01 2.388000E-04 401 175 2.190000E-01 2.332000E-04 401 176 2.202000E-01 2.279000E-04 401 177 2.215000E-01 2.228000E-04 401 178 2.227000E-01 2.180000E-04 401 179 2.240000E-01 2.133000E-04 401 180 2.252000E-01 2.090000E-04 401 181 2.265000E-01 2.048000E-04 401 182 2.277000E-01 2.008000E-04 401 183 2.290000E-01 1.970000E-04 401 184 2.303000E-01 1.935000E-04 401 185 2.315000E-01 1.901000E-04 401 186 2.328000E-01 1.869000E-04 401 187 2.340000E-01 1.839000E-04 401 188 2.353000E-01 1.810000E-04 401 189 2.365000E-01 1.783000E-04 401 190 2.378000E-01 1.758000E-04 401 191 2.390000E-01 1.734000E-04 401 192 2.403000E-01 1.711000E-04 401 193 2.416000E-01 1.690000E-04 401 194 2.428000E-01 1.670000E-04 401 195 2.441000E-01 1.651000E-04 401 196 2.453000E-01 1.633000E-04 401 197 2.466000E-01 1.616000E-04 401 198 2.478000E-01 1.601000E-04 401 199 2.491000E-01 1.586000E-04 401 200 2.503000E-01 1.572000E-04 401 201 2.516000E-01 1.558000E-04 401 202 2.529000E-01 1.546000E-04 401 203 2.541000E-01 1.534000E-04 401 204 2.554000E-01 1.523000E-04 401 205 2.566000E-01 1.512000E-04 401 206 2.579000E-01 1.502000E-04 401 207 2.591000E-01 1.492000E-04 401 208 2.604000E-01 1.483000E-04 401 209 2.616000E-01 1.474000E-04 401 210 2.629000E-01 1.465000E-04 401 211 2.642000E-01 1.456000E-04 401 212 2.654000E-01 1.448000E-04 401 213 2.667000E-01 1.440000E-04 401 214 2.679000E-01 1.432000E-04 401 215 2.692000E-01 1.424000E-04 401 216 2.704000E-01 1.416000E-04 401 217 2.717000E-01 1.409000E-04 401 218 2.729000E-01 1.401000E-04 401 219 2.742000E-01 1.394000E-04 401 220 2.755000E-01 1.387000E-04 401 221 2.767000E-01 1.379000E-04 401 222 2.780000E-01 1.372000E-04 401 223 2.792000E-01 1.365000E-04 401 224 2.805000E-01 1.358000E-04 401 225 2.817000E-01 1.350000E-04 401 226 2.830000E-01 1.343000E-04 401 227 2.842000E-01 1.336000E-04 401 228 2.855000E-01 1.329000E-04 401 229 2.868000E-01 1.322000E-04 401 230 2.880000E-01 1.316000E-04 401 231 2.893000E-01 1.309000E-04 401 232 2.905000E-01 1.302000E-04 401 233 2.918000E-01 1.296000E-04 401 234 2.930000E-01 1.289000E-04 401 235 2.943000E-01 1.283000E-04 401 236 2.955000E-01 1.277000E-04 401 237 2.968000E-01 1.271000E-04 401 238 2.981000E-01 1.265000E-04 401 239 2.993000E-01 1.259000E-04 401 240 3.006000E-01 1.254000E-04 401 241 3.018000E-01 1.248000E-04 401 242 3.031000E-01 1.243000E-04 401 243 3.043000E-01 1.238000E-04 401 244 3.056000E-01 1.234000E-04 401 245 3.068000E-01 1.229000E-04 401 246 3.081000E-01 1.225000E-04 401 247 3.094000E-01 1.221000E-04 401 248 3.106000E-01 1.217000E-04 401 249 3.119000E-01 1.214000E-04 401 250 3.131000E-01 1.210000E-04 401 251 3.144000E-01 1.207000E-04 401 252 3.156000E-01 1.204000E-04 401 253 3.169000E-01 1.201000E-04 401 254 3.181000E-01 1.199000E-04 401 255 3.194000E-01 1.196000E-04 401 256 3.207000E-01 1.194000E-04 401 257 3.219000E-01 1.192000E-04 401 258 3.232000E-01 1.190000E-04 401 259 3.244000E-01 1.188000E-04 401 260 3.257000E-01 1.186000E-04 401 261 3.269000E-01 1.184000E-04 401 262 3.282000E-01 1.183000E-04 401 263 3.294000E-01 1.181000E-04 401 264 3.307000E-01 1.179000E-04 401 265 3.320000E-01 1.178000E-04 401 266 3.332000E-01 1.176000E-04 401 267 3.345000E-01 1.175000E-04 401 268 3.357000E-01 1.173000E-04 401 269 3.370000E-01 1.171000E-04 401 270 3.382000E-01 1.169000E-04 401 271 3.395000E-01 1.167000E-04 401 272 3.407000E-01 1.165000E-04 401 273 3.420000E-01 1.163000E-04 401 274 3.433000E-01 1.161000E-04 401 275 3.445000E-01 1.158000E-04 401 276 3.458000E-01 1.156000E-04 401 277 3.470000E-01 1.153000E-04 401 278 3.483000E-01 1.150000E-04 401 279 3.495000E-01 1.147000E-04 401 280 3.508000E-01 1.143000E-04 401 281 3.520000E-01 1.140000E-04 401 282 3.533000E-01 1.136000E-04 401 283 3.546000E-01 1.132000E-04 401 284 3.558000E-01 1.128000E-04 401 285 3.571000E-01 1.124000E-04 401 286 3.583000E-01 1.119000E-04 401 287 3.596000E-01 1.114000E-04 401 288 3.608000E-01 1.109000E-04 401 289 3.621000E-01 1.104000E-04 401 290 3.633000E-01 1.099000E-04 401 291 3.646000E-01 1.094000E-04 401 292 3.659000E-01 1.088000E-04 401 293 3.671000E-01 1.083000E-04 401 294 3.684000E-01 1.077000E-04 #