{
  "code": "SASDXL3",
  "status": "Published",
  "type_of_curve": "Merged",
  "angular_unit": "1/nm",
  "project": {
    "title": "Unveiling the structure, function and dynamics of StmPr1 in Stenotrophomonas maltophilia virulence.",
    "publication": {
      "title": "Unveiling the structure, function and dynamics of StmPr1 in Stenotrophomonas maltophilia virulence.",
      "author_list": "Sommer M, Negm A, Outzen L, Windhorst S, Gabdulkhakov A, Weber W, Betzel C",
      "journal": "Sci Rep",
      "doi": "10.1038/s41598-025-06177-5",
      "pmid": "40542111",
      "published_date": "2025 Jun 20"
    },
    "status": "released",
    "submitted_date": "2025-04-13",
    "released_date": "2025-06-23"
  },
  "pddf_data": null,
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXL3.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXL3_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXL3_kratky_img.png",
  "pddf_plot": null,
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXL3_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXL3.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 6M",
        "resolution": null
      },
      "name": "PETRA III",
      "city": "DESY; Hamburg",
      "country": "Germany",
      "beamline_name": "EMBL P12",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Alkaline serine protease (Δ1-150)",
          "short_name": "StmPr1",
          "sequence": "LAPNDPYYQQYQWHLHNATGGINAPSAWDVSQGEGVVVAVLDTGILPQHPDLVGNLLEGYDFISDAETSRRATNDRVPGAQDYGDWVENDNECYTGSVAEDSSWHGTHVAGTVAEQTNNGVGMAGVAHKAKVLPVRVLGKCGGYLSDIADAITWASGGTVAGVPANANPAEVINMSLGGSGSCDGTYQDAINGAISRGTTVVVAAGNETDNASKYRPASCDGVVTVGATRITGGITYYSNYGSRVDLSGPGGGGSVDGNPGGYVWQSGSDAATTPESGSYSYMGMGGTSMASPHVAAVAALVQSALIAKGKDPLAPAAMRTLLKETARPFPVSIPTATPIGTGIVDAKAALAKALEEPCTENCGPVATPLTNKTAVGGLNGTAGSSRLYSFEAAAGKQLSVITYGGTGNVSVYIAQGREPSASDNDGKSTRPGTSETVRVNKPVAGTYYIKVVGEAAYNGVSILATQ",
          "organism": "Stenotrophomonas maltophilia",
          "uniprot_code": "Q93IQ4",
          "uniprot_range_first": 151,
          "uniprot_range_last": 617,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MIKKQNLRINVLAAAVLSMTAVGAVHAAGLPTREPVRQASAAQPGTDRIIVKYRAGSAAA\nGDRSAKLSTVQSALTRASLAGGTARASTLGPQVVRRLGVGADVIRLQGRLAPAELQRVLK\nELKADPAVQYAEADVKLRRSELRAGDVQPALAPNDPYYQQYQWHLHNATGGINAPSAWDV\nSQGEGVVVAVLDTGILPQHPDLVGNLLEGYDFISDAETSRRATNDRVPGAQDYGDWVEND\nNECYTGSVAEDSSWHGTHVAGTVAEQTNNGVGMAGVAHKAKVLPVRVLGKCGGYLSDIAD\nAITWASGGTVAGVPANANPAEVINMSLGGSGSCDGTYQDAINGAISRGTTVVVAAGNETD\nNASKYRPASCDGVVTVGATRITGGITYYSNYGSRVDLSGPGGGGSVDGNPGGYVWQSGSD\nAATTPESGSYSYMGMGGTSMASPHVAAVAALVQSALIAKGKDPLAPAAMRTLLKETARPF\nPVSIPTATPIGTGIVDAKAALAKALEEPCTENCGPVATPLTNKTAVGGLNGTAGSSRLYS\nFEAAAGKQLSVITYGGTGNVSVYIAQGREPSASDNDGKSTRPGTSETVRVNKPVAGTYYI\nKVVGEAAYNGVSILATQ",
          "mw": 47.476,
          "total_mw": 47.476,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": ""
        }
      ],
      "buffer": {
        "name": "20 mM Tris, 150 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Alkaline serine protease (47 kDa peptidase core and C-terminal domains, StmPr1)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Hamburg, Germany",
            "full_name": "University of Hamburg",
            "webpage": "https://www.uni-hamburg.de/"
          }
        ],
        "contributor_name": "Max",
        "contributor_surname": "Sommer",
        "orcid": "https://orcid.org/0009-0001-8293-0177"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2021-11-25",
    "storage_temperature": 20.0,
    "cell_temperature": 20.0,
    "exposure_time": 0.05,
    "number_of_frames": 20,
    "wavelength": 0.124,
    "sample_detector_distance": 3.1,
    "concentration_min": 0.25,
    "concentration_max": 2.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.024,
    "s_max": 7.371,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": null,
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of alkaline serine protease (peptidase core and C-terminal domains) in 20 mM Tris, 150 mM NaCl, pH 8 were collected on the EMBL P12 beam line at PETRA III (DESY; Hamburg, Germany) using a Pilatus 6M detector at a sample-detector distance of 3.1 m and at a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 0.3 and 2 mg/ml were measured at 20°C. 20 successive 0.050 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
  "tags": [],
  "intensity_unit": "1/cm",
  "experimental_mw": 62.4,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 70.0,
  "porod_mw_error": null,
  "pddf_i0": null,
  "pddf_i0_error": null,
  "guinier_i0": 0.142456,
  "guinier_i0_error": null,
  "pddf_rg": null,
  "pddf_rg_error": null,
  "guinier_rg": 2.87,
  "guinier_rg_error": 0.007,
  "pddf_dmax": 10.0,
  "pddf_dmax_error": null,
  "porod_volume": 112.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 35,
  "guinier_point_last": 155,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDXL3_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-06-23T08:56:50.963067+02:00",
  "bragg_peak": []
}