{ "code": "SASDFP2", "status": "Published", "type_of_curve": "SEC-SAS", "angular_unit": "1/A", "project": { "title": "Higher order assembling of the mycobacterial polar growth factor DivIVA/Wag31.", "publication": { "title": "Higher order assembling of the mycobacterial polar growth factor DivIVA/Wag31.", "author_list": "Choukate K, Gupta A, Basu B, Virk K, Ganguli M, Chaudhuri B", "journal": "J Struct Biol", "doi": "10.1016/j.jsb.2019.107429", "pmid": "31778770", "published_date": "2019 Nov 25" }, "status": "released", "submitted_date": "2019-01-30", "released_date": "2020-01-09" }, "pddf_data": null, "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDFP2.dat", "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFP2_dat_img.png", "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFP2_kratky_img.png", "pddf_plot": null, "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFP2_guinier_img.png", "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFP2.sascif", "experiment": { "instrument": { "detector": { "type": null, "name": "Rayonix MX225-HE", "resolution": null }, "name": "Stanford Synchrotron Radiation Lightsource (SSRL)", "city": "Menlo Park, CA", "country": "USA", "beamline_name": "BL4-2", "beam_geometry": null, "type_of_source": "X-ray synchrotron", "point_source": null, "line_collimation": null, "sample_path_length": null, "line_collimation_slitlength": null, "line_collimation_integrationwidth": null, "xray_energy": null, "beam_profile_ah": null, "beam_profile_al": null }, "sample": { "molecule": [ { "long_name": "Cell wall synthesis protein Wag31", "short_name": null, "sequence": "MHHHHHHENLYFQGPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENSDLRQRINELDQEL\r\nAAGGGAGVTPQAEQAIPAYEPEPGKPAPAAVSAGMNEEQALKAARVLSLAQDTADRLTNT\r\nAKAESDKMLADARANAEQILGEARHTADATVAEARQRADAMLADAQSRSEAQLRQAQEKA\r\nDALQADAERKHSEIMGTINQQRAVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSA\r\nAPVDSNADAGGFDQFNRGKN", "organism": "Mycobacterium tuberculosis", "uniprot_code": "P9WMU1", "uniprot_range_first": null, "uniprot_range_last": null, "oligomerization": "unknown", "molecular_type": "protein", "uniprot_sequence": "MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENSDLRQRINELDQEL\nAAGGGAGVTPQATQAIPAYEPEPGKPAPAAVSAGMNEEQALKAARVLSLAQDTADRLTNT\nAKAESDKMLADARANAEQILGEARHTADATVAEARQRADAMLADAQSRSEAQLRQAQEKA\nDALQADAERKHSEIMGTINQQRAVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSA\nAPVDSNADAGGFDQFNRGKN", "mw": 29.98, "total_mw": 29.98, "number_molecules": 0, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null } ], "buffer": { "name": "50mM Tris pH7.5, 300mM NaCl, 10% Glycerol, 1mM EDTA (ethylene diamine tetra acetic acid), 5mM β-mercaptoethanol (BME)", "concentration_unit": null, "comment": null, "additive": null, "concentration": null, "pka": null, "ph": 7.5, "deuteration": null }, "purity_method": null, "name": "Cell wall synthesis protein Wag31(T73E) polymer (SEC-frames 285-289)", "ext_coefficient": null, "contrast": null, "specific_vol": null, "dry_vol": null, "absorbption": null, "deuteration": null, "mixture": null }, "contributor": [ { "affiliation": [ { "short_name": "CSIR", "address": "Chandigarh, India", "full_name": "CSIR-Institute of Microbial Technology", "webpage": "http://www.imtech.res.in/" } ], "contributor_name": "Komal", "contributor_surname": "Choukate", "orcid": "" } ], "concentration_method": null, "concentration_unit": null, "date": "2018-01-29", "storage_temperature": 23.0, "cell_temperature": 23.0, "exposure_time": 1.0, "number_of_frames": 500, "wavelength": 0.1, "sample_detector_distance": 2.54, "concentration_min": null, "concentration_max": 2.4, "sample_volume": null, "flow_rate": null, "s_min": 0.055, "s_max": 4.023, "total_exposure_time": null, "seccolumn": null }, "fits": [], "estimated_volume_method": null, "pddf_software": null, "pddf_software_version": null, "i0_calibration_standard": null, "description": "SEC-SAXS was performed at room temperature using the following parameters: Column: Superdex 200 PC3.2; Flow rate: 0.05 mL/min; Sample injection concentration: 2.4 mg/mL; Injection volume: 100 μL. 500 successive 1 second frames were collected through the SEC-elution peak.\r\nSEC-SAXS data of Cell wall synthesis protein Wag31(T73E) polymer frame no. 285-289", "experiment_description": "Synchrotron SAXS data from solutions of Cell wall synthesis protein Wag31(T73E) polymer (SEC-frames 285-289) in 50mM Tris pH7.5, 300mM NaCl, 10% Glycerol, 1mM EDTA (ethylene diamine tetra acetic acid), 5mM β-mercaptoethanol (BME), pH 7.5 were collected on the BL4-2 beam line at the Stanford Synchrotron Radiation Lightsource (SSRL) storage ring (Stanford, CA, USA) using a Rayonix MX225-HE detector at a sample-detector distance of 2.5 m and at a wavelength of λ = 0.1 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 2.40 mg/ml was measured at 23°C. 500 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.", "tags": [], "intensity_unit": "arbitrary", "experimental_mw": 29.97, "experimental_mw_error": null, "guinier_i0_mw": null, "guinier_i0_mw_error": null, "porod_mw": null, "porod_mw_error": null, "pddf_i0": null, "pddf_i0_error": null, "guinier_i0": 12.58, "guinier_i0_error": null, "pddf_rg": null, "pddf_rg_error": null, "guinier_rg": 8.057, "guinier_rg_error": null, "pddf_dmax": null, "pddf_dmax_error": null, "porod_volume": null, "porod_volume_error": null, "estimated_volume": null, "estimated_volume_error": null, "guinier_point_first": 2, "guinier_point_last": 26, "pddf_point_first": null, "pddf_point_last": null, "i0_calibration_standard_data": null, "intensities_log_log_plot": "SASDFP2_datloglog_img.png", "symmetry": null, "last_modified": "2020-08-13T15:34:10.382959+02:00", "bragg_peak": [] }