{
  "code": "SASDXP2",
  "status": "Published",
  "type_of_curve": "Co-flow SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "New structural insights into the control of the retinoic acid receptors RAR/RXR by DNA, ligands, and transcriptional coregulators.",
    "publication": {
      "title": "New structural insights into the control of the retinoic acid receptors RAR/RXR by DNA, ligands, and transcriptional coregulators.",
      "author_list": "Tambones I, Sagar A, Vankova P, Loginov D, Carivenc C, Rochel N, Bourguet W, Man P, Bernadó P, le Maire A",
      "journal": "Nucleic Acids Res",
      "doi": "10.1093/nar/gkaf967",
      "pmid": "41036627",
      "published_date": "2025 Sep 23"
    },
    "status": "released",
    "submitted_date": "2025-03-19",
    "released_date": "2025-10-13"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDXP2.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXP2.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXP2_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXP2_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDXP2_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXP2_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXP2.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Eiger 4M",
        "resolution": 75.0
      },
      "name": "SOLEIL",
      "city": "Saint-Aubin",
      "country": "France",
      "beamline_name": "SWING",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Retinoic acid receptor alpha",
          "short_name": "RARα",
          "sequence": "GSHMPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLKMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLD",
          "organism": "Mus musculus",
          "uniprot_code": "P11416",
          "uniprot_range_first": 82,
          "uniprot_range_last": 421,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPAT\nIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM\nVYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTL\nTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV\nEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA\nGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALK\nVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL\nDTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP",
          "mw": 39.156,
          "total_mw": 39.156,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "Receptor for retinoic acid (PubMed:17205979). Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes (PubMed:17205979). The RXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5 (PubMed:17205979). In the absence of ligand, the RXR-RAR heterodimers associate with a multiprotein complex containing transcription corepressors that induce histone deacetylation, chromatin condensation and transcriptional suppression (By similarity)."
        },
        {
          "long_name": "BMS493 (RAR inverse agonist ligand)",
          "short_name": null,
          "sequence": "C29H24O2",
          "organism": null,
          "uniprot_code": null,
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "other",
          "uniprot_sequence": "",
          "mw": 0.404,
          "total_mw": 0.404,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "MS493 is an inverse pan-retinoic acid receptor (RAR) agonist. BMS493 increases nuclear corepressor interaction with RARs. BMS493 also could prevent retinoic acid-induced differentiation[1][2]. BMS493 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups."
        },
        {
          "long_name": "Retinoid X receptor alpha",
          "short_name": "RXRα",
          "sequence": "GSNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT",
          "organism": "Homo sapiens",
          "uniprot_code": "P19793",
          "uniprot_range_first": 126,
          "uniprot_range_last": 462,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING\nMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP\nAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID\nKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL\nAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL\nLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM\nQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL\nRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT",
          "mw": 38.381,
          "total_mw": 38.381,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "Receptor for retinoic acid that acts as a transcription factor (PubMed:10874028, PubMed:11162439, PubMed:11915042, PubMed:37478846). Forms homo- or heterodimers with retinoic acid receptors (RARs) and binds to target response elements in response to their ligands, all-trans or 9-cis retinoic acid, to regulate gene expression in various biological processes (PubMed:10195690, PubMed:11162439, PubMed:11915042, PubMed:16107141, PubMed:17761950, PubMed:18800767, PubMed:19167885, PubMed:28167758, PubMed:37478846). The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5 to regulate transcription (PubMed:10195690, PubMed:11162439, PubMed:11915042, PubMed:17761950, PubMed:28167758)."
        },
        {
          "long_name": "Direct Repeat binding site with one-base-pair spacing",
          "short_name": "DR1",
          "sequence": "ctAGGTCAaAGGTCAgc\r\ngcTGACCTtTGACCTag",
          "organism": null,
          "uniprot_code": null,
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "DNA",
          "uniprot_sequence": "",
          "mw": 10.523,
          "total_mw": 10.523,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "Retinoic acid responsive element (RARE) idealized."
        }
      ],
      "buffer": {
        "name": "20 mM Tris HCl, 75 mM NaCl, 75 mM KCl, 2 mM CHAPS, 4 mM MgCl₂, 12 mM TCEP",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "RAR/RXR heterodimer : BMS493 : DR1 element",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "Centre de Biologie Structurale (CBS), CNRS, INSERM, Univ Montpellier ",
            "webpage": null
          }
        ],
        "contributor_name": "Izabella",
        "contributor_surname": "Tambones",
        "orcid": "https://orcid.org/0000-0002-4073-9227"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2022-04-20",
    "storage_temperature": 15.0,
    "cell_temperature": 15.0,
    "exposure_time": 1.99,
    "number_of_frames": 990,
    "wavelength": 0.10332,
    "sample_detector_distance": 2.0,
    "concentration_min": null,
    "concentration_max": 10.0,
    "sample_volume": 50.0,
    "flow_rate": 0.2,
    "s_min": 0.05,
    "s_max": 5.592,
    "total_exposure_time": null,
    "seccolumn": 1
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": null,
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 86.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 75.0,
  "porod_mw_error": null,
  "pddf_i0": 0.03474,
  "pddf_i0_error": null,
  "guinier_i0": 0.0344484,
  "guinier_i0_error": null,
  "pddf_rg": 3.9,
  "pddf_rg_error": null,
  "guinier_rg": 3.8,
  "guinier_rg_error": 0.002,
  "pddf_dmax": 13.94,
  "pddf_dmax_error": null,
  "porod_volume": 120.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 23,
  "guinier_point_last": 56,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDXP2_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-10-13T13:31:27.441739+02:00",
  "bragg_peak": []
}