data_SASDES4_MAIN # _sas_result.id 1113 _sas_result.SASBDB_code SASDES4 _sas_result.experimental_MW 126.000 _sas_result.experimental_MW_error . _sas_result.MW_standard 118.000 _sas_result.MW_standard_error 15.000 _sas_result.MW_Porod 126.000 _sas_result.MW_Porod_error . _sas_result.I0_from_PR 0.1185000000 _sas_result.I0_from_PR_error 0.0010000000 _sas_result.I0_from_Guinier 0.1100000000 _sas_result.I0_from_Guinier_error 0.0010000000 _sas_result.Rg_from_PR 4.250 _sas_result.Rg_from_PR_error 0.050 _sas_result.Rg_from_Guinier 4.000 _sas_result.Rg_from_Guinier_error 0.300 _sas_result.D_max 13.00 _sas_result.Porod_volume 202.00 _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min 2 _sas_result.Guinier_point_max 10 _sas_result.type_of_curve single_conc _sas_result.standard . _sas_result.Dmax_error 0.50 _sas_result.comments 'ACA8 protein (apo) encapsulated in a partially deuterated "stealth-nanodisc": (sND). Disc components (MSP1D1 scaffold protein - 75% deuterated, and POPC lipid - heads/tails 78% and 92% deuterated) are effectively matched out at 100% D2O. Thus the expected molecular weight should correspond to that of the ACA8 protein (~118 kDa). Data measured using a single instrument configuration: 5.5 m (sample-detector distances) with a fixed neutron wavelength (λ) of 5 Å.' # _sas_scan.title "ACA8 in stealth nanodisc (SANS, 100% D2O)" _sas_scan.detc_id 67 _sas_scan.id 1113 _sas_scan.measurement_date 2017-08-28 _sas_scan.storage_temperature 10.0 _sas_scan.cell_temperature 10.0 _sas_scan.exposure_time 7200.000 _sas_scan.number_of_frames 1 _sas_scan.unit 1/A _sas_scan.qmin 0.0155 _sas_scan.qmax 0.2336 _sas_scan.sample_id 1073 _sas_scan.result_id 1113 _sas_scan.beam_id 91 # _sas_beam.id 91 _sas_beam.instrument_name "Heinz Maier-Leibnitz Zentrum SANS-1" _sas_beam.instrument_city Garching _sas_beam.instrument_country Germany _sas_beam.shape . _sas_beam.type_of_source "neutron source" _sas_beam.radiation_wavelength 0.500000 _sas_beam.dist_spec_to_detc 5.50000 # _sas_detc.id 67 _sas_detc.name MLZ _sas_detc.type "Array of 128 3-He position sensitive tubes" _sas_detc.pixsize_x 8.000 # _sas_sample.id 1073 _sas_sample.name "ACA8 in stealth nanodisc (SANS, 100% D2O)" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration 3.50 _sas_sample.concentration_method . loop_ _sas_sample.entity_id 1017 1018 1312 # _sas_buffer.id 691 _sas_buffer.name "30 mM Tris, 150 mM NaCl, 1mM MgCl2, 1 mM CaCl2" _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.500 _sas_buffer.comment . _sas_buffer.composition . _sas_buffer.sample_id 1073 # loop_ _entity.id _entity.type _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules 1017 protein "Membrane scaffold protein 1D1 (deuterated, 75%)" 24.661 2 1018 other "1-palmitoyl-2-palmitoleoyl-sn-glycero-3-phosphocholine (deuteration: 78% head, 92% acyl)" 0.760 . 1312 protein "Calcium-transporting ATPase 8, plasma membrane-type" 118.209 1 # loop_ _entity_name_com.entity_id _entity_name_com.name 1017 d75-msp1d1 1018 d(78,92)-POPC 1312 ACA8 # loop_ _entity_poly.entity_id _entity_poly.pdbx_seq_one_letter_code 1017 ;GHHHHHHHDYDIPTTENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEM SKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQE KLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEY HAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ ; 1018 C42H82NO8P 1312 ;HHHHHHHHENLYFQGS MTSLLKSSPGRRRGGDVESGKSEHADSDSDTFYIPSKNASIERLQQWRKAALVLNASRRF RYTLDLKKEQETREMRQKIRSHAHALLAANRFMDMGRESGVEKTTGPATPAGDFGITPEQ LVIMSKDHNSGALEQYGGTQGLANLLKTNPEKGISGDDDDLLKRKTIYGSNTYPRKKGKG FLRFLWDACHDLTLIILMVAAVASLALGIKTEGIKEGWYDGGSIAFAVILVIVVTAVSDY KQSLQFQNLNDEKRNIHLEVLRGGRRVEISIYDIVVGDVIPLNIGNQVPADGVLISGHSL ALDESSMTGESKIVNKDANKDPFLMSGCKVADGNGSMLVTGVGVNTEWGLLMASISEDNG EETPLQVRLNGVATFIGSIGLAVAAAVLVILLTRYFTGHTKDNNGGPQFVKGKTKVGHVI DDVVKVLTVAVTIVVVAVPEGLPLAVTLTLAYSMRKMMADKALVRRLSACETMGSATTIC SDKTGTLTLNQMTVVESYAGGKKTDTEQLPATITSLVVEGISQNTTGSIFVPEGGGDLEY SGSPTEKAILGWGVKLGMNFETARSQSSILHAFPFNSEKKRGGVAVKTADGEVHVHWKGA SEIVLASCRSYIDEDGNVAPMTDDKASFFKNGINDMAGRTLRCVALAFRTYEAEKVPTGE ELSKWVLPEDDLILLAIVGIKDPCRPGVKDSVVLCQNAGVKVRMVTGDNVQTARAIALEC GILSSDADLSEPTLIEGKSFREMTDAERDKISDKISVMGRSSPNDKLLLVQSLRRQGHVV AVTGDGTNDAPALHEADIGLAMGIAGTEVAKESSDIIILDDNFASVVKVVRWGRSVYANI QKFIQFQLTVNVAALVINVVAAISSGDVPLTAVQLLWVNLIMDTLGALALATEPPTDHLM GRPPVGRKEPLITNIMWRNLLIQAIYQVSVLLTLNFRGISILGLEHEVHEHATRVKNTII FNAFVLCQAFNEFNARKPDEKNIFKGVIKNRLFMGIIVITLVLQVIIVEFLGKFASTTKL NWKQWLICVGIGVISWPLALVGKFIPVPAAPISNKLKVLKFWGKKKNSSGEGSL ; # loop_ _entity_src_gen.entity_id _entity_src_gen.gene_src_common_name 1017 . 1018 "Escherichia coli. (AL95 strain)" 1312 "Arabidopsis thaliana" # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code 1 1017 UniProt . 2 1018 UniProt . 3 1312 UniProt Q9LF79 _struct_ref.details http://www.uniprot.org/uniprot/Q9LF79 # _citation.id 403 _citation.title "Structural basis for activation of plasma-membrane Ca2+-ATPase by calmodulin" _citation.year "2018 Dec" _citation.pdbx_database_id_DOI 10.1038/s42003-018-0203-7 _citation.pdbx_database_id_PubMed . # loop_ _citation_author.citation_id _citation_author.ordinal _citation_author.name 403 1 "Nitsche J" 403 2 "Josts I" 403 3 "Heidemann J" 403 4 "Mertens H" 403 5 "Maric S" 403 6 "Moulin M" 403 7 "Haertlein M" 403 8 "Busch S" 403 9 "Forsyth V" 403 10 "Svergun D" 403 11 "Uetrecht C" # _pdbx_contact_author.id 12 _pdbx_contact_author.name_first Haydyn _pdbx_contact_author.name_last Mertens _pdbx_contact_author.role . _pdbx_contact_author.address_1 EMBL-Hamburg _pdbx_contact_author.address_2 "European Molecular Biology Laboratory (EMBL) - Hamburg outstation" _pdbx_contact_author.address_3 "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany" # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 1.554000E-02 9.526000E-02 2.077443E-03 1113 2 1.736000E-02 9.492870E-02 1.628730E-03 1113 3 1.919000E-02 9.340940E-02 1.542514E-03 1113 4 2.102000E-02 8.993960E-02 1.426640E-03 1113 5 2.285000E-02 8.908830E-02 1.299499E-03 1113 6 2.467000E-02 8.369220E-02 1.261685E-03 1113 7 2.650000E-02 7.873980E-02 1.218200E-03 1113 8 2.833000E-02 7.420160E-02 1.197984E-03 1113 9 3.015000E-02 6.933810E-02 1.166377E-03 1113 10 3.198000E-02 6.620560E-02 1.137385E-03 1113 11 3.381000E-02 6.106620E-02 1.146863E-03 1113 12 3.563000E-02 5.667590E-02 1.080849E-03 1113 13 3.746000E-02 5.216610E-02 1.071691E-03 1113 14 3.928000E-02 4.922090E-02 1.047300E-03 1113 15 4.111000E-02 4.777430E-02 1.016854E-03 1113 16 4.294000E-02 4.190820E-02 1.011077E-03 1113 17 4.476000E-02 3.982510E-02 9.703015E-04 1113 18 4.659000E-02 3.672360E-02 9.707169E-04 1113 19 4.841000E-02 3.401520E-02 9.403317E-04 1113 20 5.024000E-02 3.111940E-02 9.198043E-04 1113 21 5.206000E-02 3.122200E-02 9.080224E-04 1113 22 5.388000E-02 2.644330E-02 8.762165E-04 1113 23 5.571000E-02 2.558970E-02 8.890195E-04 1113 24 5.753000E-02 2.228560E-02 8.719856E-04 1113 25 5.935000E-02 2.169810E-02 8.465317E-04 1113 26 6.118000E-02 2.136710E-02 8.350944E-04 1113 27 6.300000E-02 1.960240E-02 8.130695E-04 1113 28 6.482000E-02 1.766720E-02 8.333469E-04 1113 29 6.665000E-02 1.618970E-02 7.961991E-04 1113 30 6.847000E-02 1.647130E-02 7.932357E-04 1113 31 7.029000E-02 1.413760E-02 7.948688E-04 1113 32 7.211000E-02 1.367270E-02 7.657540E-04 1113 33 7.393000E-02 1.209250E-02 7.705165E-04 1113 34 7.575000E-02 1.286420E-02 7.412205E-04 1113 35 7.757000E-02 1.159800E-02 7.469560E-04 1113 36 7.939000E-02 1.139940E-02 7.479885E-04 1113 37 8.121000E-02 9.216400E-03 7.255951E-04 1113 38 8.303000E-02 9.879700E-03 7.346922E-04 1113 39 8.485000E-02 8.367000E-03 6.985566E-04 1113 40 8.667000E-02 8.831800E-03 7.240480E-04 1113 41 8.849000E-02 8.210700E-03 6.964932E-04 1113 42 9.030000E-02 9.288000E-03 6.886106E-04 1113 43 9.212000E-02 6.655700E-03 6.857317E-04 1113 44 9.394000E-02 7.705000E-03 6.802968E-04 1113 45 9.575000E-02 6.598000E-03 6.883804E-04 1113 46 9.757000E-02 6.510600E-03 6.612724E-04 1113 47 9.938000E-02 5.737400E-03 6.674820E-04 1113 48 1.012000E-01 4.931700E-03 6.549768E-04 1113 49 1.030000E-01 5.744400E-03 6.469551E-04 1113 50 1.048000E-01 3.502200E-03 6.548145E-04 1113 51 1.066000E-01 4.566900E-03 6.265820E-04 1113 52 1.085000E-01 4.500700E-03 6.403315E-04 1113 53 1.103000E-01 3.650000E-03 6.327385E-04 1113 54 1.121000E-01 3.802100E-03 6.541012E-04 1113 55 1.139000E-01 2.852800E-03 6.713643E-04 1113 56 1.157000E-01 3.119000E-03 6.794237E-04 1113 57 1.175000E-01 2.055600E-03 7.256160E-04 1113 58 1.193000E-01 1.965400E-03 7.178726E-04 1113 59 1.211000E-01 3.403400E-03 7.300912E-04 1113 60 1.229000E-01 3.504800E-03 7.338345E-04 1113 61 1.247000E-01 2.021700E-03 7.334333E-04 1113 62 1.266000E-01 2.245700E-03 7.716416E-04 1113 63 1.284000E-01 1.462600E-03 7.359763E-04 1113 64 1.302000E-01 1.402000E-03 7.576689E-04 1113 65 1.320000E-01 1.899200E-03 7.568744E-04 1113 66 1.338000E-01 5.162000E-04 7.538315E-04 1113 67 1.356000E-01 1.738600E-03 7.763840E-04 1113 68 1.374000E-01 7.175000E-04 7.535054E-04 1113 69 1.392000E-01 2.248400E-03 7.725554E-04 1113 70 1.410000E-01 1.324500E-03 7.594866E-04 1113 71 1.428000E-01 8.808000E-04 7.685460E-04 1113 72 1.446000E-01 8.766000E-04 7.789473E-04 1113 73 1.464000E-01 9.428000E-04 7.695178E-04 1113 74 1.482000E-01 8.244000E-04 7.873488E-04 1113 75 1.500000E-01 -4.431000E-04 7.708157E-04 1113 76 1.518000E-01 1.621600E-03 7.778877E-04 1113 77 1.536000E-01 2.123000E-03 7.854187E-04 1113 78 1.554000E-01 1.659600E-03 7.844142E-04 1113 79 1.572000E-01 1.439900E-03 8.043701E-04 1113 80 1.590000E-01 1.525800E-03 7.728656E-04 1113 81 1.608000E-01 5.976000E-04 7.837651E-04 1113 82 1.626000E-01 1.565200E-03 7.928216E-04 1113 83 1.644000E-01 1.642600E-03 7.926273E-04 1113 84 1.661000E-01 4.863000E-04 7.952017E-04 1113 85 1.679000E-01 3.835000E-04 7.909452E-04 1113 86 1.697000E-01 3.060800E-03 7.900534E-04 1113 87 1.715000E-01 2.007400E-03 8.064266E-04 1113 88 1.733000E-01 1.991900E-03 7.983577E-04 1113 89 1.751000E-01 1.872200E-03 7.905520E-04 1113 90 1.769000E-01 9.103000E-04 7.966599E-04 1113 91 1.787000E-01 1.591900E-03 8.072294E-04 1113 92 1.805000E-01 1.990400E-03 8.035989E-04 1113 93 1.822000E-01 7.778000E-04 7.992084E-04 1113 94 1.840000E-01 7.891000E-04 7.931395E-04 1113 95 1.858000E-01 2.055200E-03 8.080566E-04 1113 96 1.876000E-01 2.365000E-03 8.124328E-04 1113 97 1.894000E-01 1.890400E-03 8.109096E-04 1113 98 1.912000E-01 2.625600E-03 8.070662E-04 1113 99 1.929000E-01 8.848000E-04 8.006248E-04 1113 100 1.947000E-01 1.145400E-03 8.110752E-04 1113 101 1.965000E-01 1.298900E-03 8.113391E-04 1113 102 1.983000E-01 1.400300E-03 8.079088E-04 1113 103 2.001000E-01 4.214000E-04 8.076403E-04 1113 104 2.018000E-01 1.097500E-03 8.241369E-04 1113 105 2.036000E-01 5.581000E-04 8.109939E-04 1113 106 2.054000E-01 2.343900E-03 8.109722E-04 1113 107 2.071000E-01 9.439000E-04 8.578570E-04 1113 108 2.089000E-01 2.688900E-03 9.620930E-04 1113 109 2.107000E-01 -7.095000E-04 1.037163E-03 1113 110 2.125000E-01 -2.743000E-04 1.081222E-03 1113 111 2.142000E-01 4.276200E-03 1.140513E-03 1113 112 2.160000E-01 6.693000E-04 1.213351E-03 1113 113 2.178000E-01 2.655100E-03 1.329131E-03 1113 114 2.195000E-01 2.056500E-03 1.350550E-03 1113 115 2.213000E-01 -5.406000E-04 1.445606E-03 1113 116 2.231000E-01 2.011300E-03 1.627837E-03 1113 117 2.248000E-01 3.384000E-04 1.874537E-03 1113 118 2.266000E-01 7.538000E-04 1.953713E-03 1113 119 2.283000E-01 4.088700E-03 2.194345E-03 1113 120 2.301000E-01 1.952300E-03 2.682683E-03 1113 121 2.319000E-01 4.177400E-03 3.778600E-03 1113 122 2.336000E-01 -2.437800E-03 6.725988E-03 1113 # _sas_p_of_R_details.id 1113 _sas_p_of_R_details.intensity_id 1113 _sas_p_of_R_details.software_p_of_R "GNOM 5.0" _sas_p_of_R_details.number_of_points 101 _sas_p_of_R_details.qmin 0.01919 _sas_p_of_R_details.qmax 0.2001 _sas_p_of_R_details.p_of_R_point_min 1 _sas_p_of_R_details.p_of_R_point_max 101 _sas_p_of_R_details.Rmin 0.0 _sas_p_of_R_details.Rmax 130.0 # loop_ _sas_p_of_R.id _sas_p_of_R.ordinal _sas_p_of_R.r _sas_p_of_R.P _sas_p_of_R.P_error 1113 1 0.000000E+00 0.000000E+00 0.000000E+00 1113 2 1.646000E+00 6.076000E-06 6.127000E-07 1113 3 3.291000E+00 1.232000E-05 9.837000E-07 1113 4 4.937000E+00 1.876000E-05 1.138000E-06 1113 5 6.582000E+00 2.540000E-05 1.114000E-06 1113 6 8.228000E+00 3.226000E-05 9.734000E-07 1113 7 9.873000E+00 3.936000E-05 8.099000E-07 1113 8 1.152000E+01 4.670000E-05 7.625000E-07 1113 9 1.316000E+01 5.430000E-05 9.082000E-07 1113 10 1.481000E+01 6.212000E-05 1.160000E-06 1113 11 1.646000E+01 7.013000E-05 1.413000E-06 1113 12 1.810000E+01 7.827000E-05 1.608000E-06 1113 13 1.975000E+01 8.644000E-05 1.719000E-06 1113 14 2.139000E+01 9.455000E-05 1.743000E-06 1113 15 2.304000E+01 1.025000E-04 1.693000E-06 1113 16 2.468000E+01 1.100000E-04 1.602000E-06 1113 17 2.633000E+01 1.171000E-04 1.517000E-06 1113 18 2.797000E+01 1.236000E-04 1.486000E-06 1113 19 2.962000E+01 1.293000E-04 1.537000E-06 1113 20 3.127000E+01 1.342000E-04 1.655000E-06 1113 21 3.291000E+01 1.380000E-04 1.803000E-06 1113 22 3.456000E+01 1.409000E-04 1.938000E-06 1113 23 3.620000E+01 1.426000E-04 2.034000E-06 1113 24 3.785000E+01 1.432000E-04 2.079000E-06 1113 25 3.949000E+01 1.429000E-04 2.078000E-06 1113 26 4.114000E+01 1.416000E-04 2.049000E-06 1113 27 4.278000E+01 1.394000E-04 2.020000E-06 1113 28 4.443000E+01 1.366000E-04 2.020000E-06 1113 29 4.608000E+01 1.332000E-04 2.068000E-06 1113 30 4.772000E+01 1.294000E-04 2.162000E-06 1113 31 4.937000E+01 1.254000E-04 2.283000E-06 1113 32 5.101000E+01 1.214000E-04 2.405000E-06 1113 33 5.266000E+01 1.175000E-04 2.503000E-06 1113 34 5.430000E+01 1.138000E-04 2.564000E-06 1113 35 5.595000E+01 1.105000E-04 2.581000E-06 1113 36 5.759000E+01 1.075000E-04 2.560000E-06 1113 37 5.924000E+01 1.049000E-04 2.519000E-06 1113 38 6.089000E+01 1.027000E-04 2.477000E-06 1113 39 6.253000E+01 1.008000E-04 2.458000E-06 1113 40 6.418000E+01 9.930000E-05 2.476000E-06 1113 41 6.582000E+01 9.797000E-05 2.533000E-06 1113 42 6.747000E+01 9.675000E-05 2.622000E-06 1113 43 6.911000E+01 9.555000E-05 2.724000E-06 1113 44 7.076000E+01 9.426000E-05 2.822000E-06 1113 45 7.241000E+01 9.279000E-05 2.900000E-06 1113 46 7.405000E+01 9.107000E-05 2.950000E-06 1113 47 7.570000E+01 8.903000E-05 2.968000E-06 1113 48 7.734000E+01 8.665000E-05 2.959000E-06 1113 49 7.899000E+01 8.391000E-05 2.928000E-06 1113 50 8.063000E+01 8.082000E-05 2.884000E-06 1113 51 8.228000E+01 7.741000E-05 2.838000E-06 1113 52 8.392000E+01 7.373000E-05 2.796000E-06 1113 53 8.557000E+01 6.985000E-05 2.765000E-06 1113 54 8.722000E+01 6.584000E-05 2.747000E-06 1113 55 8.886000E+01 6.176000E-05 2.744000E-06 1113 56 9.051000E+01 5.770000E-05 2.752000E-06 1113 57 9.215000E+01 5.373000E-05 2.770000E-06 1113 58 9.380000E+01 4.990000E-05 2.793000E-06 1113 59 9.544000E+01 4.626000E-05 2.817000E-06 1113 60 9.709000E+01 4.285000E-05 2.841000E-06 1113 61 9.873000E+01 3.968000E-05 2.862000E-06 1113 62 1.004000E+02 3.677000E-05 2.883000E-06 1113 63 1.020000E+02 3.410000E-05 2.907000E-06 1113 64 1.037000E+02 3.165000E-05 2.940000E-06 1113 65 1.053000E+02 2.940000E-05 2.988000E-06 1113 66 1.070000E+02 2.733000E-05 3.054000E-06 1113 67 1.086000E+02 2.538000E-05 3.138000E-06 1113 68 1.103000E+02 2.353000E-05 3.235000E-06 1113 69 1.119000E+02 2.175000E-05 3.331000E-06 1113 70 1.135000E+02 2.000000E-05 3.412000E-06 1113 71 1.152000E+02 1.825000E-05 3.459000E-06 1113 72 1.168000E+02 1.648000E-05 3.454000E-06 1113 73 1.185000E+02 1.468000E-05 3.380000E-06 1113 74 1.201000E+02 1.282000E-05 3.221000E-06 1113 75 1.218000E+02 1.090000E-05 2.967000E-06 1113 76 1.234000E+02 8.904000E-06 2.607000E-06 1113 77 1.251000E+02 6.825000E-06 2.134000E-06 1113 78 1.267000E+02 4.654000E-06 1.545000E-06 1113 79 1.284000E+02 2.383000E-06 8.345000E-07 1113 80 1.300000E+02 0.000000E+00 0.000000E+00 # loop_ _sas_p_of_R_extrapolated_intensity.id _sas_p_of_R_extrapolated_intensity.ordinal _sas_p_of_R_extrapolated_intensity.momentum_transfer _sas_p_of_R_extrapolated_intensity.intensity_reg 1113 1 0.000000E+00 1.184570E-01 1113 2 1.744550E-03 1.182400E-01 1113 3 3.489090E-03 1.175920E-01 1113 4 5.233640E-03 1.165210E-01 1113 5 6.978180E-03 1.150390E-01 1113 6 8.722730E-03 1.131650E-01 1113 7 1.046730E-02 1.109190E-01 1113 8 1.221180E-02 1.083280E-01 1113 9 1.395640E-02 1.054210E-01 1113 10 1.570090E-02 1.022300E-01 1113 11 1.744550E-02 9.879190E-02 1113 12 1.919000E-02 9.514180E-02 1113 13 2.102000E-02 9.112670E-02 1113 14 2.285000E-02 8.696480E-02 1113 15 2.467000E-02 8.272380E-02 1113 16 2.650000E-02 7.840000E-02 1113 17 2.833000E-02 7.405830E-02 1113 18 3.015000E-02 6.976140E-02 1113 19 3.198000E-02 6.549850E-02 1113 20 3.381000E-02 6.132640E-02 1113 21 3.563000E-02 5.729650E-02 1113 22 3.746000E-02 5.338980E-02 1113 23 3.928000E-02 4.966990E-02 1113 24 4.111000E-02 4.611290E-02 1113 25 4.294000E-02 4.275250E-02 1113 26 4.476000E-02 3.961410E-02 1113 27 4.659000E-02 3.666780E-02 1113 28 4.841000E-02 3.394680E-02 1113 29 5.024000E-02 3.141900E-02 1113 30 5.206000E-02 2.910680E-02 1113 31 5.388000E-02 2.698820E-02 1113 32 5.571000E-02 2.504360E-02 1113 33 5.753000E-02 2.328270E-02 1113 34 5.935000E-02 2.168200E-02 1113 35 6.118000E-02 2.022070E-02 1113 36 6.300000E-02 1.890130E-02 1113 37 6.482000E-02 1.770180E-02 1113 38 6.665000E-02 1.660310E-02 1113 39 6.847000E-02 1.560480E-02 1113 40 7.029000E-02 1.468860E-02 1113 41 7.211000E-02 1.384380E-02 1113 42 7.393000E-02 1.306060E-02 1113 43 7.575000E-02 1.233050E-02 1113 44 7.757000E-02 1.164600E-02 1113 45 7.939000E-02 1.100110E-02 1113 46 8.121000E-02 1.039050E-02 1113 47 8.303000E-02 9.810260E-03 1113 48 8.485000E-02 9.257290E-03 1113 49 8.667000E-02 8.729290E-03 1113 50 8.849000E-02 8.224660E-03 1113 51 9.030000E-02 7.744900E-03 1113 52 9.212000E-02 7.284110E-03 1113 53 9.394000E-02 6.844670E-03 1113 54 9.575000E-02 6.428660E-03 1113 55 9.757000E-02 6.031440E-03 1113 56 9.938000E-02 5.657330E-03 1113 57 1.012000E-01 5.302080E-03 1113 58 1.030000E-01 4.971220E-03 1113 59 1.048000E-01 4.660370E-03 1113 60 1.066000E-01 4.369110E-03 1113 61 1.085000E-01 4.082250E-03 1113 62 1.103000E-01 3.829260E-03 1113 63 1.121000E-01 3.593700E-03 1113 64 1.139000E-01 3.374690E-03 1113 65 1.157000E-01 3.171280E-03 1113 66 1.175000E-01 2.982560E-03 1113 67 1.193000E-01 2.807590E-03 1113 68 1.211000E-01 2.645490E-03 1113 69 1.229000E-01 2.495470E-03 1113 70 1.247000E-01 2.356790E-03 1113 71 1.266000E-01 2.222020E-03 1113 72 1.284000E-01 2.104790E-03 1113 73 1.302000E-01 1.997280E-03 1113 74 1.320000E-01 1.899140E-03 1113 75 1.338000E-01 1.810090E-03 1113 76 1.356000E-01 1.729900E-03 1113 77 1.374000E-01 1.658360E-03 1113 78 1.392000E-01 1.595290E-03 1113 79 1.410000E-01 1.540470E-03 1113 80 1.428000E-01 1.493660E-03 1113 81 1.446000E-01 1.454570E-03 1113 82 1.464000E-01 1.422840E-03 1113 83 1.482000E-01 1.398020E-03 1113 84 1.500000E-01 1.379600E-03 1113 85 1.518000E-01 1.366970E-03 1113 86 1.536000E-01 1.359480E-03 1113 87 1.554000E-01 1.356370E-03 1113 88 1.572000E-01 1.356850E-03 1113 89 1.590000E-01 1.360090E-03 1113 90 1.608000E-01 1.365270E-03 1113 91 1.626000E-01 1.371560E-03 1113 92 1.644000E-01 1.378150E-03 1113 93 1.661000E-01 1.383980E-03 1113 94 1.679000E-01 1.389100E-03 1113 95 1.697000E-01 1.392550E-03 1113 96 1.715000E-01 1.393850E-03 1113 97 1.733000E-01 1.392610E-03 1113 98 1.751000E-01 1.388580E-03 1113 99 1.769000E-01 1.381620E-03 1113 100 1.787000E-01 1.371710E-03 1113 101 1.805000E-01 1.358920E-03 1113 102 1.822000E-01 1.344370E-03 1113 103 1.840000E-01 1.326600E-03 1113 104 1.858000E-01 1.306730E-03 1113 105 1.876000E-01 1.285120E-03 1113 106 1.894000E-01 1.262200E-03 1113 107 1.912000E-01 1.238400E-03 1113 108 1.929000E-01 1.215470E-03 1113 109 1.947000E-01 1.191120E-03 1113 110 1.965000E-01 1.167030E-03 1113 111 1.983000E-01 1.143530E-03 1113 112 2.001000E-01 1.120860E-03 #