data_SASDBS7_MAIN # _sas_result.id 441 _sas_result.SASBDB_code SASDBS7 _sas_result.experimental_MW 184.000 _sas_result.experimental_MW_error . _sas_result.MW_standard 84.010 _sas_result.MW_standard_error 1.700 _sas_result.MW_Porod . _sas_result.MW_Porod_error . _sas_result.I0_from_PR . _sas_result.I0_from_PR_error . _sas_result.I0_from_Guinier 307000.0000000000 _sas_result.I0_from_Guinier_error 12400.0000000000 _sas_result.Rg_from_PR . _sas_result.Rg_from_PR_error . _sas_result.Rg_from_Guinier 5.810 _sas_result.Rg_from_Guinier_error 0.380 _sas_result.D_max . _sas_result.Porod_volume . _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min 1 _sas_result.Guinier_point_max 11 _sas_result.type_of_curve single_conc _sas_result.standard . _sas_result.Dmax_error . _sas_result.comments ;From the depositor: "Protein signal is blanked out in 50% sucrose, only DNA contributes to the scattering. Hence, the SAXS profile reports the Rg and molecule weight of the DNA in the nucleosome core particle complex." ; # _sas_scan.title "Nucleosome Core Particle: 1.2 M NaCl, 50% sucrose," _sas_scan.detc_id 19 _sas_scan.id 441 _sas_scan.measurement_date 2014-04-14 _sas_scan.storage_temperature . _sas_scan.cell_temperature 20.0 _sas_scan.exposure_time 0.010 _sas_scan.number_of_frames 5 _sas_scan.unit 1/A _sas_scan.qmin 0.0060 _sas_scan.qmax 0.1950 _sas_scan.sample_id 399 _sas_scan.result_id 441 _sas_scan.beam_id 38 # _sas_beam.id 38 _sas_beam.instrument_name "Advanced Photon Source (APS) BioCAT 18ID" _sas_beam.instrument_city "Argonne, IL" _sas_beam.instrument_country USA _sas_beam.shape . _sas_beam.type_of_source "X-ray synchrotron" _sas_beam.radiation_wavelength 0.125000 _sas_beam.dist_spec_to_detc 2.50000 # _sas_detc.id 19 _sas_detc.name "Pilatus 100K" _sas_detc.type . _sas_detc.pixsize_x 172.000 # _sas_sample.id 399 _sas_sample.name "Nucleosome Core Particle: 1.2 M NaCl, 50% sucrose, 50ms - 10s time resolved data" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration 3.00 _sas_sample.concentration_method . loop_ _sas_sample.entity_id 445 446 447 # _sas_buffer.id 219 _sas_buffer.name "20 mM Tris-Cl, 0.1 mM EDTA, 0.1 mM DTT, 50% sucrose, 1.2 M NaCl" _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.500 _sas_buffer.comment . _sas_buffer.composition . _sas_buffer.sample_id 399 # loop_ _entity.id _entity.type _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules 445 protein "Nucleasome Core Particle with Widom 601 DNA - HISTONE H2A-H2B Heterodimer" 23.754 2 446 protein "Nucleasome Core Particle with Widom 601 DNA - HISTONE H3-H4 Heterodimer" 23.168 2 447 DNA "Nucleasome Core Particle with Widom 601 DNA - dsDNA" 92.093 1 # loop_ _entity_name_com.entity_id _entity_name_com.name 445 . 446 . 447 . # loop_ _entity_poly.entity_id _entity_poly.pdbx_seq_one_letter_code 445 ;GKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK ; 446 ;LATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG ; 447 ;ATCGGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCGAT ATCGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCCGAT ; # loop_ _entity_src_gen.entity_id _entity_src_gen.gene_src_common_name 445 "Xenopus laevis" 446 "Xenopus laevis" 447 "Xenopus laevis" # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code 1 445 UniProt . 2 446 UniProt . 3 447 UniProt . # _citation.id 231 _citation.title "Asymmetric unwrapping of nucleosomal DNA propagates asymmetric opening and dissociation of the histone core." _citation.year "2017 Jan 10" _citation.pdbx_database_id_DOI 10.1073/pnas.1611118114 _citation.pdbx_database_id_PubMed 28028239 _citation.journal_abbrev "Proc Natl Acad Sci U S A" _citation.journal_volume 114 _citation.journal_issue 2 _citation.page_first 334 _citation.page_last 339 # loop_ _citation_author.citation_id _citation_author.ordinal _citation_author.name 231 1 "Chen Y" 231 2 "Tokuda JM" 231 3 "Topping T" 231 4 "Meisburger SP" 231 5 "Pabit SA" 231 6 "Gloss LM" # _pdbx_contact_author.id 113 _pdbx_contact_author.name_first Yujie _pdbx_contact_author.name_last Chen _pdbx_contact_author.role . _pdbx_contact_author.address_1 . _pdbx_contact_author.address_2 "Cornell University" _pdbx_contact_author.address_3 "Ithaca, NY, United States" # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 6.000000E-03 2.509106E+05 5.452806E+04 441 2 7.500000E-03 2.750882E+05 2.911544E+04 441 3 9.000000E-03 3.020035E+05 2.072495E+04 441 4 1.050000E-02 2.849046E+05 1.631418E+04 441 5 1.200000E-02 2.585932E+05 1.369471E+04 441 6 1.350000E-02 2.447856E+05 1.230348E+04 441 7 1.500000E-02 2.345402E+05 1.129287E+04 441 8 1.650000E-02 2.200074E+05 1.129336E+04 441 9 1.800000E-02 2.164100E+05 1.073543E+04 441 10 1.950000E-02 1.864948E+05 9.960473E+03 441 11 2.100000E-02 1.994687E+05 9.845534E+03 441 12 2.250000E-02 1.705587E+05 1.005982E+04 441 13 2.400000E-02 1.537482E+05 1.036340E+04 441 14 2.550000E-02 1.291007E+05 1.004486E+04 441 15 2.700000E-02 1.359833E+05 1.006048E+04 441 16 2.850000E-02 1.196814E+05 9.902990E+03 441 17 3.000000E-02 1.090034E+05 9.723214E+03 441 18 3.150000E-02 1.078096E+05 9.592501E+03 441 19 3.300000E-02 1.076132E+05 9.272198E+03 441 20 3.450000E-02 7.407097E+04 9.269587E+03 441 21 3.600000E-02 8.568379E+04 8.944573E+03 441 22 3.750000E-02 7.170940E+04 8.814932E+03 441 23 3.900000E-02 6.248210E+04 8.744867E+03 441 24 4.050000E-02 5.671586E+04 8.576071E+03 441 25 4.200000E-02 4.792584E+04 8.603809E+03 441 26 4.350000E-02 5.240649E+04 8.428808E+03 441 27 4.500000E-02 6.175137E+04 8.384585E+03 441 28 4.650000E-02 4.258289E+04 8.259100E+03 441 29 4.800000E-02 4.736719E+04 8.105257E+03 441 30 4.950000E-02 3.423117E+04 8.043290E+03 441 31 5.100000E-02 4.666750E+04 7.980246E+03 441 32 5.250000E-02 5.470750E+04 7.985951E+03 441 33 5.400000E-02 3.842734E+04 7.754487E+03 441 34 5.550000E-02 4.268421E+04 7.697470E+03 441 35 5.700000E-02 2.473023E+04 7.624558E+03 441 36 5.850000E-02 1.618265E+04 7.518231E+03 441 37 6.000000E-02 3.165081E+04 7.519137E+03 441 38 6.150000E-02 2.851135E+04 7.920146E+03 441 39 6.300000E-02 2.267877E+04 8.209631E+03 441 40 6.450000E-02 3.068208E+04 8.417984E+03 441 41 6.600000E-02 2.362130E+04 8.511025E+03 441 42 6.750000E-02 2.611850E+04 8.702623E+03 441 43 6.900000E-02 1.526764E+04 8.627406E+03 441 44 7.050000E-02 2.046226E+04 8.829869E+03 441 45 7.200000E-02 2.360630E+04 8.660010E+03 441 46 7.350000E-02 1.177215E+04 8.847177E+03 441 47 7.500000E-02 2.450893E+04 8.960659E+03 441 48 7.650000E-02 1.609974E+04 8.918297E+03 441 49 7.800000E-02 1.433442E+04 8.886128E+03 441 50 7.950000E-02 2.115039E+04 8.885383E+03 441 51 8.100000E-02 1.018092E+04 8.932684E+03 441 52 8.250000E-02 2.074315E+04 8.905779E+03 441 53 8.400000E-02 1.855229E+04 8.948420E+03 441 54 8.550000E-02 3.631158E+04 9.086210E+03 441 55 8.700000E-02 3.081464E+04 9.011891E+03 441 56 8.850000E-02 3.332215E+04 9.018313E+03 441 57 9.000000E-02 1.956965E+04 8.920869E+03 441 58 9.150000E-02 1.169474E+04 9.044279E+03 441 59 9.300000E-02 1.443289E+04 9.033721E+03 441 60 9.450000E-02 1.643048E+04 8.940607E+03 441 61 9.600000E-02 6.590909E+03 9.157451E+03 441 62 9.750000E-02 1.470844E+04 9.015459E+03 441 63 9.900000E-02 1.855769E+04 9.192591E+03 441 64 1.005000E-01 1.078648E+04 9.028800E+03 441 65 1.020000E-01 1.129755E+04 9.029723E+03 441 66 1.035000E-01 3.054645E+04 9.220082E+03 441 67 1.050000E-01 1.426689E+04 9.061941E+03 441 68 1.065000E-01 1.451736E+04 9.210687E+03 441 69 1.080000E-01 1.469932E+04 9.136787E+03 441 70 1.095000E-01 1.344660E+04 9.144412E+03 441 71 1.110000E-01 1.436989E+04 8.998175E+03 441 72 1.125000E-01 1.480874E+04 9.080933E+03 441 73 1.140000E-01 1.474066E+04 8.975445E+03 441 74 1.155000E-01 1.715506E+04 9.151535E+03 441 75 1.170000E-01 1.290730E+04 9.195322E+03 441 76 1.185000E-01 3.193012E+04 9.098676E+03 441 77 1.200000E-01 8.973648E+03 9.205984E+03 441 78 1.215000E-01 2.342196E+04 9.167292E+03 441 79 1.230000E-01 1.933288E+04 9.049555E+03 441 80 1.245000E-01 9.880618E+03 9.230100E+03 441 81 1.260000E-01 7.475994E+03 9.084102E+03 441 82 1.275000E-01 -7.842514E+03 9.234120E+03 441 83 1.290000E-01 1.015369E+04 9.137632E+03 441 84 1.305000E-01 1.138579E+03 9.116357E+03 441 85 1.320000E-01 -2.569444E+02 9.230515E+03 441 86 1.335000E-01 1.436981E+03 9.190957E+03 441 87 1.350000E-01 -7.206091E+03 9.325667E+03 441 88 1.365000E-01 1.075550E+04 9.093781E+03 441 89 1.380000E-01 2.492987E+03 9.250352E+03 441 90 1.395000E-01 -2.938719E+03 8.873873E+03 441 91 1.410000E-01 5.576658E+03 9.050554E+03 441 92 1.425000E-01 -1.990453E+04 9.099940E+03 441 93 1.440000E-01 7.420470E+03 9.053255E+03 441 94 1.455000E-01 2.450213E+03 9.212918E+03 441 95 1.470000E-01 9.948347E+03 9.037896E+03 441 96 1.485000E-01 6.084507E+03 9.196875E+03 441 97 1.500000E-01 -1.471329E+04 9.233960E+03 441 98 1.515000E-01 -2.058067E+04 9.144141E+03 441 99 1.530000E-01 5.665954E+03 9.395729E+03 441 100 1.545000E-01 -1.348005E+03 9.093842E+03 441 101 1.560000E-01 -9.257925E+02 9.384463E+03 441 102 1.575000E-01 5.320690E+03 9.151893E+03 441 103 1.590000E-01 6.011158E+03 9.178915E+03 441 104 1.605000E-01 -1.806543E+03 9.343071E+03 441 105 1.620000E-01 -1.071031E+04 9.151067E+03 441 106 1.635000E-01 -1.026466E+04 9.118038E+03 441 107 1.650000E-01 -8.036451E+03 8.732721E+03 441 108 1.665000E-01 -1.575532E+04 9.141821E+03 441 109 1.680000E-01 -9.193776E+01 9.216038E+03 441 110 1.695000E-01 -1.480876E+04 9.036541E+03 441 111 1.710000E-01 -1.043929E+04 9.190212E+03 441 112 1.725000E-01 2.277469E+03 9.064813E+03 441 113 1.740000E-01 -6.316547E+03 9.214052E+03 441 114 1.755000E-01 5.459254E+03 9.216033E+03 441 115 1.770000E-01 1.179478E+04 9.154416E+03 441 116 1.785000E-01 -1.438119E+04 9.189540E+03 441 117 1.800000E-01 1.102941E+03 9.172620E+03 441 118 1.815000E-01 9.550360E+03 9.362578E+03 441 119 1.830000E-01 -2.555402E+03 9.128787E+03 441 120 1.845000E-01 -9.259259E+02 9.220003E+03 441 121 1.860000E-01 1.513732E+04 9.265953E+03 441 122 1.875000E-01 4.856039E+03 9.224484E+03 441 123 1.890000E-01 -7.228959E+03 9.204818E+03 441 124 1.905000E-01 4.335366E+03 1.202137E+04 441 125 1.920000E-01 2.399267E+03 1.495164E+04 441 126 1.935000E-01 -3.239691E+04 1.726502E+04 441 127 1.950000E-01 5.255475E+03 2.058054E+04 441 #