{ "code": "SASDBT7", "status": "Published", "type_of_curve": "Single concentration", "angular_unit": "1/A", "project": { "title": "Asymmetric unwrapping of nucleosomal DNA propagates asymmetric opening and dissociation of the histone core.", "publication": { "title": "Asymmetric unwrapping of nucleosomal DNA propagates asymmetric opening and dissociation of the histone core.", "author_list": "Chen Y, Tokuda JM, Topping T, Meisburger SP, Pabit SA, Gloss LM, Pollack L", "journal": "Proc Natl Acad Sci U S A", "doi": "10.1073/pnas.1611118114", "pmid": "28028239", "published_date": "2017 Jan 10" }, "status": "released", "submitted_date": "2016-10-27", "released_date": "2017-02-15" }, "pddf_data": null, "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBT7.dat", "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBT7_dat_img.png", "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBT7_kratky_img.png", "pddf_plot": null, "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBT7_guinier_img.png", "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBT7.sascif", "experiment": { "instrument": { "detector": { "type": null, "name": "Pilatus 100K", "resolution": 172.0 }, "name": "Advanced Photon Source (APS), Argonne National Laboratory", "city": "Lemont, IL", "country": "USA", "beamline_name": "BioCAT 18ID", "beam_geometry": null, "type_of_source": "X-ray synchrotron", "point_source": null, "line_collimation": null, "sample_path_length": null, "line_collimation_slitlength": null, "line_collimation_integrationwidth": null, "xray_energy": null, "beam_profile_ah": null, "beam_profile_al": null }, "sample": { "molecule": [ { "long_name": "Nucleasome Core Particle with Widom 601 DNA - HISTONE H2A-H2B Heterodimer", "short_name": null, "sequence": "GKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK\r\n\r\nKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK", "organism": "Xenopus laevis", "uniprot_code": null, "uniprot_range_first": null, "uniprot_range_last": null, "oligomerization": "dimer", "molecular_type": "protein", "uniprot_sequence": null, "mw": 23.754, "total_mw": 47.508, "number_molecules": 2, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null }, { "long_name": "Nucleasome Core Particle with Widom 601 DNA - HISTONE H3-H4 Heterodimer", "short_name": null, "sequence": "LATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA\r\n\r\nKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG", "organism": "Xenopus laevis", "uniprot_code": null, "uniprot_range_first": null, "uniprot_range_last": null, "oligomerization": "dimer", "molecular_type": "protein", "uniprot_sequence": null, "mw": 23.168, "total_mw": 46.336, "number_molecules": 2, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null }, { "long_name": "Nucleasome Core Particle with Widom 601 DNA - dsDNA", "short_name": null, "sequence": "ATCGGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCGAT\r\n \r\n\r\nATCGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCCGAT", "organism": "Xenopus laevis", "uniprot_code": null, "uniprot_range_first": null, "uniprot_range_last": null, "oligomerization": "monomer", "molecular_type": "DNA", "uniprot_sequence": null, "mw": 92.093, "total_mw": 92.093, "number_molecules": 1, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null } ], "buffer": { "name": "20 mM Tris-Cl, 0.1 mM EDTA, 0.1 mM DTT, 50% sucrose, 1.9 M NaCl", "concentration_unit": null, "comment": null, "additive": null, "concentration": null, "pka": null, "ph": 7.5, "deuteration": null }, "purity_method": null, "name": "Nucleosome Core Particle: 1.9 M NaCl, 50% sucrose, 50ms - 10s time resolved data", "ext_coefficient": null, "contrast": null, "specific_vol": null, "dry_vol": null, "absorbption": null, "deuteration": null, "mixture": null }, "contributor": [ { "affiliation": [ { "short_name": null, "address": "Ithaca, NY, United States", "full_name": "Cornell University", "webpage": "https://www.cornell.edu/" } ], "contributor_name": "Yujie", "contributor_surname": "Chen", "orcid": null } ], "concentration_method": null, "concentration_unit": null, "date": "2014-04-14", "storage_temperature": 0.0, "cell_temperature": 20.0, "exposure_time": 0.01, "number_of_frames": 5, "wavelength": 0.125, "sample_detector_distance": 2.5, "concentration_min": null, "concentration_max": 2.0, "sample_volume": null, "flow_rate": null, "s_min": 0.06, "s_max": 1.95, "total_exposure_time": null, "seccolumn": null }, "fits": [], "estimated_volume_method": null, "pddf_software": null, "pddf_software_version": null, "i0_calibration_standard": null, "description": "From the depositor:\r\n\"Protein signal is blanked out in 50% sucrose, only DNA contributes to the scattering. \r\nHence, the SAXS profile reports the Rg and molecule weight of the DNA in the nucleosome core particle complex.\"", "experiment_description": "Synchrotron SAXS data from solutions of Nucleosome Core Particle in 20 mM Tris-Cl, 0.1 mM EDTA, 0.1 mM DTT, 50% sucrose, 1.9 M NaCl, pH 7.5 were collected on the 18ID beam line at the Advanced Photon Source (APS), Argonne National Laboratory (Lemont, IL, USA) using a Pilatus 100K detector at a sample-detector distance of 2.5 m and at a wavelength of λ = 0.125 nm (I(s) vs s, where s = 4π sin θ/λ and 2θ is the scattering angle). One solute concentration of 2.00 mg/ml was measured at 20°C through a time-course spanning 50 ms to 10 s (with a 50 ms delay time). The data displayed in this entry represent the scattering after 50 ms; the remaining data from the time series can be located in the full-entry zip archive.", "tags": [], "intensity_unit": null, "experimental_mw": 186.0, "experimental_mw_error": null, "guinier_i0_mw": 80.95, "guinier_i0_mw_error": 2.8, "porod_mw": null, "porod_mw_error": null, "pddf_i0": null, "pddf_i0_error": null, "guinier_i0": 146000.0, "guinier_i0_error": 10100.0, "pddf_rg": null, "pddf_rg_error": null, "guinier_rg": 6.78, "guinier_rg_error": 0.641, "pddf_dmax": null, "pddf_dmax_error": null, "porod_volume": null, "porod_volume_error": null, "estimated_volume": null, "estimated_volume_error": null, "guinier_point_first": 1, "guinier_point_last": 10, "pddf_point_first": null, "pddf_point_last": null, "i0_calibration_standard_data": null, "intensities_log_log_plot": "SASDBT7_datloglog_img.png", "symmetry": null, "last_modified": "2019-12-06T13:07:15.624532+01:00", "bragg_peak": [] }